Psyllid ID: psy877

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHAQKK
ccccccccccccEEEEEccHHHHHHHHHHHHHccHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHcccc
cHHHHHHHccccEEEEcccHHHHHHHHHHHHHccHHHHHHHcccEEEccccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEcccEcccEEcccccccEEEEEEccccccccHHHHHHHHHHHHHcccc
migepscwlirgstaripnkdsangceirwsstglmdrIREVksvyceprrndelENVMLGYFTAIKQAelrssntsekntgALLFTIFRGkisegidfaDNYARSVisvgipfpsiqdeKVKLKRSYndthaqkk
migepscwlirgstaripnkdsangceirwsstglmdriREVKSvyceprrndeleNVMLGYFTAIKQaelrssntsekntGALLFTIFRGKISEGIDFADNYARSVISVgipfpsiqdekvklkrsyndthaqkk
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHAQKK
******CWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQA***********TGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSI*******************
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIK***************ALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSY*D******
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKR**********
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHAQKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
Q9BX63 1249 Fanconi anemia group J pr yes N/A 0.720 0.078 0.444 3e-19
Q5SXJ3 1174 Fanconi anemia group J pr yes N/A 0.735 0.085 0.436 4e-19
Q3YK19 1252 Fanconi anemia group J pr yes N/A 0.705 0.076 0.443 6e-18
Q7QEI1 991 Regulator of telomere elo yes N/A 0.860 0.118 0.330 7e-17
Q29FS3 1009 Regulator of telomere elo yes N/A 0.838 0.112 0.352 3e-16
B4GU19 1009 Regulator of telomere elo N/A N/A 0.838 0.112 0.352 3e-16
Q16X92 1010 Regulator of telomere elo N/A N/A 0.830 0.111 0.349 3e-16
B4JNS2 986 Regulator of telomere elo N/A N/A 0.808 0.111 0.355 4e-16
B4L1Z2 1014 Regulator of telomere elo N/A N/A 0.801 0.107 0.35 4e-16
B4M891 1005 Regulator of telomere elo N/A N/A 0.838 0.113 0.352 5e-16
>sp|Q9BX63|FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens GN=BRIP1 PE=1 SV=1 Back     alignment and function desciption
 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 73/108 (67%), Gaps = 10/108 (9%)

Query: 29  RWSSTGLMDRIREVKSVYCEPRRNDE--LENVMLGYFTAIKQAELRSSNTSEKNTGALLF 86
           RW STGL   +  VK+V  EP+  ++   + ++  Y+ AIK          EK+ GALL 
Sbjct: 707 RWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYK-------GEKD-GALLV 758

Query: 87  TIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHAQ 134
            + RGK+SEG+DF+D+ AR+VI++GIPFP+++D +V+LKR YND H++
Sbjct: 759 AVCRGKVSEGLDFSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSK 806
DNA-dependent ATPase and 5' to 3' DNA helicase required for the maintenance of chromosomal stability. Acts late in the Fanconi anemia pathway, after FANCD2 ubiquitination. Involved in the repair of DNA double-strand breaks by homologous recombination in a manner that depends on its association with BRCA1.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q5SXJ3|FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus GN=Brip1 PE=2 SV=1 Back     alignment and function description
>sp|Q3YK19|FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus GN=BRIP1 PE=2 SV=1 Back     alignment and function description
>sp|Q7QEI1|RTEL1_ANOGA Regulator of telomere elongation helicase 1 homolog OS=Anopheles gambiae GN=AGAP000634 PE=3 SV=5 Back     alignment and function description
>sp|Q29FS3|RTEL1_DROPS Regulator of telomere elongation helicase 1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA17940 PE=3 SV=2 Back     alignment and function description
>sp|B4GU19|RTEL1_DROPE Regulator of telomere elongation helicase 1 homolog OS=Drosophila persimilis GN=GL14463 PE=3 SV=1 Back     alignment and function description
>sp|Q16X92|RTEL1_AEDAE Regulator of telomere elongation helicase 1 homolog OS=Aedes aegypti GN=AAEL008960 PE=3 SV=1 Back     alignment and function description
>sp|B4JNS2|RTEL1_DROGR Regulator of telomere elongation helicase 1 homolog OS=Drosophila grimshawi GN=GH24089 PE=3 SV=1 Back     alignment and function description
>sp|B4L1Z2|RTEL1_DROMO Regulator of telomere elongation helicase 1 homolog OS=Drosophila mojavensis GN=GI15901 PE=3 SV=1 Back     alignment and function description
>sp|B4M891|RTEL1_DROVI Regulator of telomere elongation helicase 1 homolog OS=Drosophila virilis GN=GJ16649 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
328714715 912 PREDICTED: Fanconi anemia group J protei 0.742 0.110 0.472 1e-23
328714717 918 PREDICTED: Fanconi anemia group J protei 0.742 0.110 0.472 1e-23
405960555 1410 Fanconi anemia group J protein [Crassost 0.875 0.084 0.411 7e-21
307202440 293 Fanconi anemia group J protein [Harpegna 0.816 0.378 0.421 1e-20
160333450 1217 BRCA1 interacting protein C-terminal hel 0.897 0.100 0.398 2e-20
339240165 822 fanconi anemia group J protein-like prot 0.852 0.141 0.438 2e-20
324502086 962 Fanconi anemia group J protein [Ascaris 0.735 0.103 0.461 4e-20
340379357 1055 PREDICTED: hypothetical protein LOC10063 0.772 0.099 0.435 5e-20
348532245 1236 PREDICTED: Fanconi anemia group J protei 0.882 0.097 0.389 3e-19
390345521 1704 PREDICTED: Fanconi anemia group J protei 0.75 0.059 0.458 3e-19
>gi|328714715|ref|XP_003245432.1| PREDICTED: Fanconi anemia group J protein homolog isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 73/108 (67%), Gaps = 7/108 (6%)

Query: 29  RWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTI 88
           RW  TG ++R++++K V CEPRR D+LE +M  Y+ A++  E   S       GAL   +
Sbjct: 724 RWQVTGQLNRLKQIKVVMCEPRRGDQLEELMTKYYAAVRGDEKGPS-------GALFLAV 776

Query: 89  FRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHAQKK 136
           +RGKISEG+DF+DN AR+V++VGIPFP+ +D  V  K+ YND H + K
Sbjct: 777 YRGKISEGLDFSDNNARAVVAVGIPFPNYKDAAVTHKKDYNDKHHKNK 824

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328714717|ref|XP_001943091.2| PREDICTED: Fanconi anemia group J protein homolog isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|405960555|gb|EKC26471.1| Fanconi anemia group J protein [Crassostrea gigas] Back     alignment and taxonomy information
>gi|307202440|gb|EFN81860.1| Fanconi anemia group J protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|160333450|ref|NP_001103766.1| BRCA1 interacting protein C-terminal helicase 1 [Danio rerio] gi|126843119|gb|ABO27623.1| Fanconi anemia J [Danio rerio] Back     alignment and taxonomy information
>gi|339240165|ref|XP_003376008.1| fanconi anemia group J protein-like protein [Trichinella spiralis] gi|316975301|gb|EFV58747.1| fanconi anemia group J protein-like protein [Trichinella spiralis] Back     alignment and taxonomy information
>gi|324502086|gb|ADY40918.1| Fanconi anemia group J protein [Ascaris suum] Back     alignment and taxonomy information
>gi|340379357|ref|XP_003388193.1| PREDICTED: hypothetical protein LOC100635447 [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|348532245|ref|XP_003453617.1| PREDICTED: Fanconi anemia group J protein [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|390345521|ref|XP_781875.3| PREDICTED: Fanconi anemia group J protein-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
ZFIN|ZDB-GENE-081107-11 1217 brip1 "BRCA1 interacting prote 0.897 0.100 0.398 2.3e-20
UNIPROTKB|G3N0I3756 BRIP1 "Uncharacterized protein 0.882 0.158 0.389 1.1e-17
UNIPROTKB|E1BNG9 1098 BRIP1 "Uncharacterized protein 0.882 0.109 0.389 2e-17
UNIPROTKB|F1MMS0 1164 BRIP1 "Uncharacterized protein 0.882 0.103 0.389 2.1e-17
UNIPROTKB|J3QSE8 994 BRIP1 "Fanconi anemia group J 0.720 0.098 0.444 2.2e-17
WB|WBGene00001049983 dog-1 [Caenorhabditis elegans 0.801 0.110 0.456 2.8e-17
MGI|MGI:2442836 1174 Brip1 "BRCA1 interacting prote 0.735 0.085 0.436 2.8e-17
UNIPROTKB|Q9BX63 1249 BRIP1 "Fanconi anemia group J 0.720 0.078 0.444 3e-17
RGD|1307659818 Brip1 "BRCA1 interacting prote 0.720 0.119 0.435 3.4e-17
UNIPROTKB|D4ACW5 1170 Brip1 "Protein Brip1" [Rattus 0.720 0.083 0.435 5.7e-17
ZFIN|ZDB-GENE-081107-11 brip1 "BRCA1 interacting protein C-terminal helicase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 254 (94.5 bits), Expect = 2.3e-20, P = 2.3e-20
 Identities = 51/128 (39%), Positives = 80/128 (62%)

Query:    11 RGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRND--ELENVMLGYFTAIKQ 68
             RG    +P+    +    RW++TGL D++ E K+V  EPR     + + ++  Y+ AI+ 
Sbjct:   718 RGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRG 777

Query:    69 AELRSSNTSEKNTGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSY 128
                +     EK  GALL  + RGK+SEG+DF D+ AR+V+++GIPFP+I+D +V+LK  Y
Sbjct:   778 TAAKG----EKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKY 833

Query:   129 NDTHAQKK 136
             ND HA+ +
Sbjct:   834 NDKHAKSR 841
GO:0016817 "hydrolase activity, acting on acid anhydrides" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016818 "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides" evidence=IEA
GO:0004003 "ATP-dependent DNA helicase activity" evidence=IEA
GO:0006139 "nucleobase-containing compound metabolic process" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
UNIPROTKB|G3N0I3 BRIP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNG9 BRIP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMS0 BRIP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3QSE8 BRIP1 "Fanconi anemia group J protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00001049 dog-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:2442836 Brip1 "BRCA1 interacting protein C-terminal helicase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BX63 BRIP1 "Fanconi anemia group J protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307659 Brip1 "BRCA1 interacting protein C-terminal helicase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4ACW5 Brip1 "Protein Brip1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
smart00491142 smart00491, HELICc2, helicase superfamily c-termin 3e-19
TIGR00604705 TIGR00604, rad3, DNA repair helicase (rad3) 7e-16
pfam13307165 pfam13307, Helicase_C_2, Helicase C-terminal domai 4e-15
COG1199654 COG1199, DinG, Rad3-related DNA helicases [Transcr 7e-10
>gnl|CDD|214694 smart00491, HELICc2, helicase superfamily c-terminal domain Back     alignment and domain information 
 Score = 77.3 bits (191), Expect = 3e-19
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 12/88 (13%)

Query: 43  KSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTIFRGKISEGIDFADN 102
           K V+ E + + E E ++  Y  A +              GALL  + RGK+SEGIDF D+
Sbjct: 21  KPVFIEGKDSGETEELLEKYSAACE------------ARGALLLAVARGKVSEGIDFPDD 68

Query: 103 YARSVISVGIPFPSIQDEKVKLKRSYND 130
             R+VI VGIPFP+     ++ +  Y D
Sbjct: 69  LGRAVIIVGIPFPNPDSPILRARLEYLD 96

Length = 142
>gnl|CDD|233047 TIGR00604, rad3, DNA repair helicase (rad3) Back     alignment and domain information
>gnl|CDD|222037 pfam13307, Helicase_C_2, Helicase C-terminal domain Back     alignment and domain information
>gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
KOG1133|consensus821 100.0
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 100.0
KOG1132|consensus 945 99.98
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 99.97
smart00491142 HELICc2 helicase superfamily c-terminal domain. 99.95
KOG1131|consensus 755 99.93
smart00492141 HELICc3 helicase superfamily c-terminal domain. 99.92
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.88
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.88
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.84
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.81
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.77
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.57
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 97.74
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 96.8
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 96.8
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 96.74
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 96.69
PTZ00424401 helicase 45; Provisional 96.67
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 96.62
PRK09401 1176 reverse gyrase; Reviewed 96.5
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 96.48
PTZ00110545 helicase; Provisional 96.42
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 96.39
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 96.37
smart0049082 HELICc helicase superfamily c-terminal domain. 96.03
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 95.95
PRK14701 1638 reverse gyrase; Provisional 95.69
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 95.68
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 95.0
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 94.99
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 94.97
KOG0343|consensus 758 94.9
PHA02558501 uvsW UvsW helicase; Provisional 94.7
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 94.52
KOG0342|consensus 543 94.13
PRK05298 652 excinuclease ABC subunit B; Provisional 93.19
PRK04914 956 ATP-dependent helicase HepA; Validated 92.36
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 92.28
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 92.19
PRK13767 876 ATP-dependent helicase; Provisional 91.79
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 91.52
KOG0345|consensus 567 91.31
PRK01172 674 ski2-like helicase; Provisional 90.61
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 90.26
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 90.19
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 89.44
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 88.95
KOG0344|consensus 593 88.82
PRK13766 773 Hef nuclease; Provisional 88.72
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 87.3
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 86.64
TIGR00643630 recG ATP-dependent DNA helicase RecG. 86.6
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 85.88
KOG0348|consensus 708 85.37
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 85.29
PRK10689 1147 transcription-repair coupling factor; Provisional 84.67
PHA02653 675 RNA helicase NPH-II; Provisional 84.4
COG4098441 comFA Superfamily II DNA/RNA helicase required for 82.3
PRK02362 737 ski2-like helicase; Provisional 81.9
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 81.84
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 81.83
>KOG1133|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.7e-35  Score=253.12  Aligned_cols=121  Identities=31%  Similarity=0.579  Sum_probs=114.0

Q ss_pred             cccccccccCcEEEEecCHHHHHHHHHHHhcCCcchhhccceeEEEcCCCchhHHHHHHHHHHHHhhhhhhcCCccCCCC
Q psy877            2 IGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNT   81 (136)
Q Consensus         2 i~~~~~~~~gg~lvFFpSY~~m~~~~~~~~~~~~~~~l~~~k~if~E~~~~~~~~~~l~~f~~~~~~~~~~~~~~~~~~~   81 (136)
                      |..++..+|||++||||||+|+.++++.|+..++..+|..+|+||.|+++.  .+++++.|.++++.+           .
T Consensus       621 ~~nL~~~VPgGvV~FfPSy~yL~~v~k~w~~~gil~ri~~kK~vF~E~k~~--~~dvl~~Ya~a~~~g-----------~  687 (821)
T KOG1133|consen  621 ISNLSNAVPGGVVCFFPSYAYLGQVRKRWEQNGILARIVGKKKVFYEPKDT--VEDVLEGYAEAAERG-----------R  687 (821)
T ss_pred             HHHHHhhCCCcEEEEeccHHHHHHHHHHHHhcchHHHhhccchhhccCccc--HHHHHHHHHHHhhcC-----------C
Confidence            456778899999999999999999999999999999999999999999987  599999999999885           5


Q ss_pred             CeEEEEeecCccccccccCCCcceEEEEEcCCCCCCCcHHHHHHHHHHHhhccC
Q psy877           82 GALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHAQK  135 (136)
Q Consensus        82 gailfaV~~Gk~SEGIDf~d~~~r~ViivGiPyp~~~d~~~~~k~~y~d~~~~~  135 (136)
                      ||+||||.|||+||||||.|++|||||+||+||||+.|.+++.|++|+|.+..+
T Consensus       688 GaiLlaVVGGKlSEGINF~D~LgRaVvvVGlPyPN~~s~EL~er~k~l~~k~~~  741 (821)
T KOG1133|consen  688 GAILLAVVGGKLSEGINFSDDLGRAVVVVGLPYPNIQSVELQERMKHLDGKLPT  741 (821)
T ss_pred             CeEEEEEeccccccccccccccccEEEEeecCCCCCCCHHHHHHHHHhhhccCC
Confidence            999999999999999999999999999999999999999999999999998754

>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 1e-15
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 2e-15
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 5e-13
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Length = 551 Back     alignment and structure
 Score = 70.8 bits (173), Expect = 1e-15
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 78  EKNTGALLFTIFRGKISEGIDFADN---YARSVISVGIPFPSIQDEKVKLKRSYNDTHAQ 134
             N   L+ ++ +GK++EGI+  +N       V+ VGIP+P   D    L +  +    +
Sbjct: 434 SANNKVLIGSVGKGKLAEGIELRNNDRSLISDVVIVGIPYPPPDDYLKILAQRVSLKMNR 493

Query: 135 K 135
           +
Sbjct: 494 E 494
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.92
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.91
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.91
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 97.65
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 97.62
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 97.55
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.55
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.46
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 97.42
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 97.42
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.26
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.24
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.16
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.1
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.08
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 97.07
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.05
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.01
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 96.96
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.93
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 95.94
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 96.75
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 96.53
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 96.53
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 96.5
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 96.4
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 96.21
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 96.14
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 95.93
4gl2_A 699 Interferon-induced helicase C domain-containing P; 95.71
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 95.54
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 95.5
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 95.36
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 95.3
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 95.03
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 95.03
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 94.93
3h1t_A590 Type I site-specific restriction-modification syst 94.84
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.71
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 94.71
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 94.57
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 94.49
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 94.41
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 94.09
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 93.99
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 93.9
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 93.58
1yks_A 440 Genome polyprotein [contains: flavivirin protease 93.51
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 93.46
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 92.92
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 92.92
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 92.73
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 92.53
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 92.25
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 92.17
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 91.99
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 90.5
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 85.63
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 83.87
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 83.05
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 81.16
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 80.42
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 80.11
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
Probab=99.92  E-value=6.5e-26  Score=193.40  Aligned_cols=103  Identities=19%  Similarity=0.282  Sum_probs=88.6

Q ss_pred             cccccccccCcEEEEecCHHHHHHHHHHHhcCCcchhhccceeEEEcCCCchhHHHHHHHHHHHHhhhhhhcCCccCCCC
Q psy877            2 IGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNT   81 (136)
Q Consensus         2 i~~~~~~~~gg~lvFFpSY~~m~~~~~~~~~~~~~~~l~~~k~if~E~~~~~~~~~~l~~f~~~~~~~~~~~~~~~~~~~   81 (136)
                      |.+++..+|||+|||||||.+|+++++.           ..++||+|+++.+ .+++++.|++               .+
T Consensus       385 i~~l~~~~~g~~lvlF~Sy~~l~~v~~~-----------~~~~v~~q~~~~~-~~~~~~~~~~---------------~~  437 (551)
T 3crv_A          385 LLKIYFQAKANVLVVFPSYEIMDRVMSR-----------ISLPKYVESEDSS-VEDLYSAISA---------------NN  437 (551)
T ss_dssp             HHHHHHHCSSEEEEEESCHHHHHHHHTT-----------CCSSEEECCSSCC-HHHHHHHTTS---------------SS
T ss_pred             HHHHHHhCCCCEEEEecCHHHHHHHHHh-----------cCCcEEEcCCCCC-HHHHHHHHHh---------------cC
Confidence            4456677899999999999999999862           1377999988643 4678888862               24


Q ss_pred             CeEEEEeecCccccccccC---CCcceEEEEEcCCCCCCCcHHHHHHHHHHHhh
Q psy877           82 GALLFTIFRGKISEGIDFA---DNYARSVISVGIPFPSIQDEKVKLKRSYNDTH  132 (136)
Q Consensus        82 gailfaV~~Gk~SEGIDf~---d~~~r~ViivGiPyp~~~d~~~~~k~~y~d~~  132 (136)
                      ++|||||+||++||||||+   |+.||+|||+|+|||+| ||.+++|++|++++
T Consensus       438 ~~vl~~v~gg~~~EGiD~~d~~g~~l~~viI~~lPfp~~-dp~~~ar~~~~~~~  490 (551)
T 3crv_A          438 KVLIGSVGKGKLAEGIELRNNDRSLISDVVIVGIPYPPP-DDYLKILAQRVSLK  490 (551)
T ss_dssp             SCEEEEESSCCSCCSSCCEETTEESEEEEEEESCCCCCC-SHHHHHHHHHTTCC
T ss_pred             CeEEEEEecceecccccccccCCcceeEEEEEcCCCCCC-CHHHHHHHHHHHHh
Confidence            7999999999999999999   99999999999999999 99999999999854
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 97.84
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.65
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.59
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.52
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 97.47
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 97.35
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 97.32
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.29
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.2
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 97.09
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.75
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.4
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 94.71
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 89.92
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 84.43
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 84.32
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 84.13
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=97.84  E-value=2.1e-05  Score=54.61  Aligned_cols=86  Identities=15%  Similarity=0.071  Sum_probs=63.4

Q ss_pred             cccccccCcEEEEecCHHHHHHHHHHHhcCCcchhhccceeEEEcCCCchhHHHHHHHHHHHHhhhhhhcCCccCCCCCe
Q psy877            4 EPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGA   83 (136)
Q Consensus         4 ~~~~~~~gg~lvFFpSY~~m~~~~~~~~~~~~~~~l~~~k~if~E~~~~~~~~~~l~~f~~~~~~~~~~~~~~~~~~~ga   83 (136)
                      ++....++-+|||+.|-...+.+...+...++-      ...+-...+..+...++++|+.               +...
T Consensus        22 ~ll~~~~~k~IIF~~s~~~~~~l~~~L~~~g~~------~~~~~~~~~~~~r~~~~~~f~~---------------~~~~   80 (155)
T d1hv8a2          22 RLLKNKEFYGLVFCKTKRDTKELASMLRDIGFK------AGAIHGDLSQSQREKVIRLFKQ---------------KKIR   80 (155)
T ss_dssp             HHHCSTTCCEEEECSSHHHHHHHHHHHHHTTCC------EEEECSSSCHHHHHHHHHHHHT---------------TSSS
T ss_pred             HHHccCCCCEEEEECchHHHHHHHhhhcccccc------cccccccchhhhhhhhhhhhhc---------------ccce
Confidence            344444556899999999999999999876531      1122222334577889999985               3456


Q ss_pred             EEEEeecCccccccccCCCcceEEEEEcCCC
Q psy877           84 LLFTIFRGKISEGIDFADNYARSVISVGIPF  114 (136)
Q Consensus        84 ilfaV~~Gk~SEGIDf~d~~~r~ViivGiPy  114 (136)
                      +|+|.  -.++||||+++  ++.||..++|.
T Consensus        81 ilv~T--~~~~~Gid~~~--v~~Vi~~d~p~  107 (155)
T d1hv8a2          81 ILIAT--DVMSRGIDVND--LNCVINYHLPQ  107 (155)
T ss_dssp             EEEEC--TTHHHHCCCSC--CSEEEESSCCS
T ss_pred             eeeeh--hHHhhhhhhcc--CcEEEEecCCC
Confidence            77776  89999999999  88999999886
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure