Diaphorina citri psyllid: psy8782

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--

MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTNIRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKLSSNNSNIFN

cEEEEEEEccccccccEEEEEEEEEEEEccEEcccccEEEEEEEEEEEcccccccccccccccccCEccccccEEEEccccEEEEEccccEEEEEcccccECccccccccccccccccccccCEEEEcccccEEEECcccEEEEEccccEEEEEEEccccccccccccccEEEccccccEEEEccccCEEEEccccCEEEEcccccCCcccccccccccccEEEccccCEEEEcccccEEEEEcccEEEEcccccEEEEEEccccccccccEEEECccccEEEEEEccccEEEEEEcccccccccccEEEEEccccccccccccccccccccccccccccCEEEEcccccEEEEEcccEEEEcccccEEEEEcccccccccccccccccCECcccccEEEEECccccCEEEECccccEEEEEEEcccEEEEEEEECccccccccccccccccEEEEEccccccccccHHHHHHccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Teneurin-m	Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Acts as a homophilic and heterophilic synaptic cell adhesion molecule that drives synapse assembly. Promotes bi-directional trans-synaptic signaling with ten-a to organize neuromuscular synapses. Function in olfactory synaptic partner matching; promotes homophilic cell adhesion between pre-synaptic olfactory receptor neurons (ORN) axons and post-synaptic projection neurons (PN) dendrites partner in the developing antennal lobe to form stable connections. Also required for peripheral axon growth cone guidance and target recognition of motor neurons.	confident	O61307

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0045211 [CC]	postsynaptic membrane	probable	GO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0031594 [CC]	neuromuscular junction	probable	GO:0005575, GO:0045202
GO:0031005 [MF]	filamin binding	probable	GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005887 [CC]	integral to plasma membrane	probable	GO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0008360 [BP]	regulation of cell shape	probable	GO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0051124 [BP]	synaptic growth at neuromuscular junction	probable	GO:0050808, GO:0048589, GO:0030154, GO:0048468, GO:0014706, GO:0022607, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0040007, GO:0048869, GO:0071840, GO:0007519, GO:0016043, GO:0048513, GO:0007416, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0007528, GO:0044707, GO:0007399, GO:0048856, GO:0044085, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0016200 [BP]	synaptic target attraction	probable	GO:0008037, GO:0030154, GO:0048468, GO:0050918, GO:0007275, GO:0044699, GO:0042330, GO:0048869, GO:0048666, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0008039, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0042221, GO:0022008, GO:0040011, GO:0048699, GO:0044707, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0032502, GO:0008150
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0016337 [BP]	cell-cell adhesion	probable	GO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0008045 [BP]	motor neuron axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0048058 [BP]	compound eye corneal lens development	probable	GO:0048749, GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0007275, GO:0044699
GO:0045467 [BP]	R7 cell development	probable	GO:0048749, GO:0044707, GO:0042051, GO:0030154, GO:0048468, GO:0045466, GO:0009653, GO:0007275, GO:0044699, GO:0042462, GO:0042461, GO:0048869, GO:0048513, GO:0048666, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0001745, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150, GO:0032502
GO:0042734 [CC]	presynaptic membrane	probable	GO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0022416 [BP]	chaeta development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KYA, chain A
Confidence level:very confident
Coverage over the Query: 82-160,174-385,405-409,425-473
View the alignment between query and template
View the model in PyMOL

Template: 2Z2N, chain A
Confidence level:very confident
Coverage over the Query: 117-158,174-314,335-407,418-424,437-468
View the alignment between query and template
View the model in PyMOL

Template: 3KYA, chain A
Confidence level:very confident
Coverage over the Query: 72-99,116-154,173-368
View the alignment between query and template
View the model in PyMOL

Template: 3HRP, chain A
Confidence level:confident
Coverage over the Query: 20-104,116-159,172-364
View the alignment between query and template
View the model in PyMOL