Psyllid ID: psy8782

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--
MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTNIRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKLSSNNSNIFN
cEEEEEEEccccccccEEEEEEEEEEEEccEEcccccEEEEEEEEEEEcccccccccccccccccEEccccccEEEEccccEEEEEccccEEEEEcccccEEccccccccccccccccccccEEEEEcccccEEEEEcccEEEEEccccEEEEEEEccccccccccccccEEEccccccEEEEccccEEEEEccccEEEEEcccccEEcccccccccccccEEEccccEEEEEcccccEEEEEcccEEEEcccccEEEEEEccccccccccEEEEEccccEEEEEEccccEEEEEEcccccccccccEEEEEccccccccccccccccccccccccccccEEEEEcccccEEEEEcccEEEEcccccEEEEEcccccccccccccccccEEEcccccEEEEEEccccEEEEEEccccEEEEEEEcccEEEEEEEEEccccccccccccccccEEEEEccccccccccHHHHHHccccccccc
cEEEEEEEccccccccEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEcEEccHccccccccccccEEcccccEEEEccccEEEEEccccEEEEEEccccEcccccccccccccHccHcccccEEEEcccccEEEEcccEEEEEccccEEEEEEEcccccccccccccccEEEEEccccEEEEEccccEEEEEccccEEEEEccccccccccccccccccHHcHcccccEEEEccccEEEEEEccEEEEEccccEEEEEEEcccccccccccEEEcccccEEEEEEccccEEEEEEcccccccccccEEEEEEccccccccccccccccccccEEEcccccEEEEccccEEEEEEcccEEEEccccEEEEEEccccccccccccccccccccHHHEEcHHccccccccEEcccccccEEEEEEccccEEcEEEEEccccEEEEEEEccccccEEEEEcccHHHHHccHHHHHHHcccccccc
MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDlqttklsghdmsiseiggwnldihhrynfhegilqkgdgsniylknkpriikttlgdghqrpldckdcngeagpkqrllapvalatapdgslfvgdfNLIRRIMTDGTVRTVVRLKnqkfekfpkILTSCflslspsgilqkgdgsniylknkpriikttlgdghqrpldckdcngeagpkqrllapvalatapdgslfvgdfNLIRRIMTDGTVRTVVRLNVTRVAYRYHIayspldgtlyisdpeshqILRVKnamdfsapdynvepavgsgerclpgdeahcgdgapardaklaypkgvavsadnilyfadgtnirmvdrdGIVTTVIgnhmhkshwkpipcegtlniEEVSETMRDIrhttgwacygtgdndhmTLIHCYGVMQDVVTSvfnnshfldvhfshqdqDLFYFVKELPQKIRDDLdelklssnnsnifn
mikftyawnrlnvyrqrvyGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKttlgdghqrplDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRlknqkfekfpkILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKttlgdghqrplDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIrrimtdgtvrtvvRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFadgtnirmvDRDGIVTTVIGnhmhkshwkpipceGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDdldelklssnnsnifn
MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGtvrtvvrlnvtrvAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTNIRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKLSSNNSNIFN
**KFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEA**KQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNV************************RDAKLAYPKGVAVSADNILYFADGTNIRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQ********************
MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTNIRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKLSSNNS**F*
MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTNIRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKLSSNNSNIFN
MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTNIRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKLSS*N*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRDIMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTNIRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKLSSNNSNIFN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query482 2.2.26 [Sep-21-2011]
O61307 2731 Teneurin-m OS=Drosophila yes N/A 0.448 0.079 0.811 8e-98
Q9VYN8 3004 Teneurin-a OS=Drosophila no N/A 0.437 0.070 0.577 7e-70
Q9W7R3 2824 Teneurin-4 OS=Danio rerio no N/A 0.730 0.124 0.306 6e-49
Q9W7R4 2590 Teneurin-3 OS=Danio rerio no N/A 0.446 0.083 0.454 2e-48
Q9UKZ4 2725 Teneurin-1 OS=Homo sapien yes N/A 0.452 0.08 0.405 9e-48
Q9WTS4 2731 Teneurin-1 OS=Mus musculu yes N/A 0.448 0.079 0.392 3e-47
Q9P273 2699 Teneurin-3 OS=Homo sapien no N/A 0.446 0.079 0.431 3e-47
Q9WTS6 2715 Teneurin-3 OS=Mus musculu no N/A 0.746 0.132 0.299 2e-46
Q9W6V6 2705 Teneurin-1 OS=Gallus gall no N/A 0.448 0.079 0.379 7e-46
Q9NT68 2774 Teneurin-2 OS=Homo sapien no N/A 0.448 0.077 0.424 1e-45
>sp|O61307|TENM_DROME Teneurin-m OS=Drosophila melanogaster GN=Ten-m PE=1 SV=2 Back     alignment and function desciption
 Score =  357 bits (917), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 200/217 (92%), Gaps = 1/217 (0%)

Query: 179  GILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGS 238
            GILQKGDGSNIYL+NKPRII TT+GDGHQRPL+C DC+G+A  KQRLLAPVALA APDGS
Sbjct: 1128 GILQKGDGSNIYLRNKPRIILTTMGDGHQRPLECPDCDGQA-TKQRLLAPVALAAAPDGS 1186

Query: 239  LFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNA 298
            LFVGDFN IRRIMTDG++RTVV+LN TRV+YRYH+A SPLDGTLY+SDPESHQI+RV++ 
Sbjct: 1187 LFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDT 1246

Query: 299  MDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTN 358
             D+S P+ N E  VGSGERCLPGDEAHCGDGA A+DAKLAYPKG+A+S+DNILYFADGTN
Sbjct: 1247 NDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTN 1306

Query: 359  IRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEV 395
            IRMVDRDGIV+T+IGNHMHKSHWKPIPCEGTL +EE+
Sbjct: 1307 IRMVDRDGIVSTLIGNHMHKSHWKPIPCEGTLKLEEM 1343
Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Acts as a homophilic and heterophilic synaptic cell adhesion molecule that drives synapse assembly. Promotes bi-directional trans-synaptic signaling with ten-a to organize neuromuscular synapses. Function in olfactory synaptic partner matching; promotes homophilic cell adhesion between pre-synaptic olfactory receptor neurons (ORN) axons and post-synaptic projection neurons (PN) dendrites partner in the developing antennal lobe to form stable connections. Also required for peripheral axon growth cone guidance and target recognition of motor neurons.
Drosophila melanogaster (taxid: 7227)
>sp|Q9VYN8|TENA_DROME Teneurin-a OS=Drosophila melanogaster GN=Ten-a PE=1 SV=2 Back     alignment and function description
>sp|Q9W7R3|TEN4_DANRE Teneurin-4 OS=Danio rerio GN=tenm4 PE=2 SV=1 Back     alignment and function description
>sp|Q9W7R4|TEN3_DANRE Teneurin-3 OS=Danio rerio GN=tenm3 PE=2 SV=1 Back     alignment and function description
>sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=TENM1 PE=1 SV=2 Back     alignment and function description
>sp|Q9WTS4|TEN1_MOUSE Teneurin-1 OS=Mus musculus GN=Tenm1 PE=1 SV=1 Back     alignment and function description
>sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=TENM3 PE=2 SV=3 Back     alignment and function description
>sp|Q9WTS6|TEN3_MOUSE Teneurin-3 OS=Mus musculus GN=Tenm3 PE=1 SV=1 Back     alignment and function description
>sp|Q9W6V6|TEN1_CHICK Teneurin-1 OS=Gallus gallus GN=TENM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=TENM2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query482
328724904 2662 PREDICTED: teneurin-3-like isoform 2 [Ac 0.365 0.066 0.852 1e-107
328724902 2927 PREDICTED: teneurin-3-like isoform 1 [Ac 0.365 0.060 0.852 1e-107
328785592 3404 PREDICTED: teneurin-3 isoform 1 [Apis me 0.448 0.063 0.843 1e-106
380012905 2564 PREDICTED: teneurin-3-like [Apis florea] 0.448 0.084 0.847 1e-106
345493429 3237 PREDICTED: teneurin-3-like [Nasonia vitr 0.448 0.066 0.824 1e-106
322790284 1879 hypothetical protein SINV_13496 [Solenop 0.450 0.115 0.834 1e-106
307187110 3344 Teneurin-3 [Camponotus floridanus] 0.448 0.064 0.838 1e-105
307196795 3360 Teneurin-3 [Harpegnathos saltator] 0.448 0.064 0.834 1e-105
332023466 3373 Teneurin-3 [Acromyrmex echinatior] 0.448 0.064 0.834 1e-105
340721624 3454 PREDICTED: teneurin-3-like [Bombus terre 0.450 0.062 0.825 1e-104
>gi|328724904|ref|XP_003248283.1| PREDICTED: teneurin-3-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 204/217 (94%)

Query: 179  GILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGS 238
            GILQKGDGSNIYLK KPRII TT+GDGHQRPLDC DC+G+ G KQRLLAPVALA+APDGS
Sbjct: 1067 GILQKGDGSNIYLKQKPRIILTTMGDGHQRPLDCIDCDGDNGLKQRLLAPVALASAPDGS 1126

Query: 239  LFVGDFNLIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNA 298
            ++VGDFNLIRRIMTDGTV+TVVRLNVTRV+YRYHIA SPLDG+L+ISDPESHQIL+VKN 
Sbjct: 1127 IYVGDFNLIRRIMTDGTVKTVVRLNVTRVSYRYHIAVSPLDGSLFISDPESHQILKVKNP 1186

Query: 299  MDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTN 358
             +FS PD+N EPAVGSGERCLPGDEAHCGDGA ARDAKLAYPKGVA+S+DNILYFADGTN
Sbjct: 1187 NNFSDPDHNWEPAVGSGERCLPGDEAHCGDGALARDAKLAYPKGVAISSDNILYFADGTN 1246

Query: 359  IRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEV 395
            IRMVD+DG+V+T+IGNHMHKSHWKPIPCEGTLN  EV
Sbjct: 1247 IRMVDKDGLVSTLIGNHMHKSHWKPIPCEGTLNTGEV 1283

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328724902|ref|XP_001945083.2| PREDICTED: teneurin-3-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328785592|ref|XP_394215.4| PREDICTED: teneurin-3 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380012905|ref|XP_003690513.1| PREDICTED: teneurin-3-like [Apis florea] Back     alignment and taxonomy information
>gi|345493429|ref|XP_001605548.2| PREDICTED: teneurin-3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322790284|gb|EFZ15283.1| hypothetical protein SINV_13496 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307187110|gb|EFN72354.1| Teneurin-3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307196795|gb|EFN78238.1| Teneurin-3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332023466|gb|EGI63709.1| Teneurin-3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340721624|ref|XP_003399217.1| PREDICTED: teneurin-3-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query482
FB|FBgn0004449 2731 Ten-m "Tenascin major" [Drosop 0.448 0.079 0.769 1.1e-103
FB|FBgn0259240 3378 Ten-a "Tenascin accessory" [Dr 0.437 0.062 0.553 4.1e-66
UNIPROTKB|F1LV44 2545 Odz3 "Protein Odz3" [Rattus no 0.448 0.084 0.401 2.7e-45
UNIPROTKB|F1RU60 2559 LOC100520416 "Uncharacterized 0.452 0.085 0.383 1e-45
UNIPROTKB|F1PUQ3 2732 ODZ1 "Uncharacterized protein" 0.454 0.080 0.390 3.6e-46
MGI|MGI:1345183 2715 Tenm3 "teneurin transmembrane 0.448 0.079 0.401 3.2e-45
UNIPROTKB|K7GQT2 2732 LOC100520416 "Uncharacterized 0.454 0.080 0.385 4.6e-46
UNIPROTKB|G5E5W9 2560 ODZ1 "Uncharacterized protein" 0.454 0.085 0.385 3.9e-46
UNIPROTKB|F1NN19 2709 ODZ1 "Uncharacterized protein" 0.454 0.080 0.372 7.4e-46
UNIPROTKB|E1C4B6 2736 ODZ1 "Uncharacterized protein" 0.454 0.080 0.372 7.6e-46
FB|FBgn0004449 Ten-m "Tenascin major" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 912 (326.1 bits), Expect = 1.1e-103, Sum P(2) = 1.1e-103
 Identities = 167/217 (76%), Positives = 188/217 (86%)

Query:   179 GILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGS 238
             GILQKGDGSNIYL+NKPRII TT+GDGHQRPL+C DC+G+A  KQRLLAPVALA APDGS
Sbjct:  1128 GILQKGDGSNIYLRNKPRIILTTMGDGHQRPLECPDCDGQA-TKQRLLAPVALAAAPDGS 1186

Query:   239 LFVGDFNLIRRIMTDGXXXXXXXXXXXXXAYRYHIAYSPLDGTLYISDPESHQILRVKNA 298
             LFVGDFN IRRIMTDG             +YRYH+A SPLDGTLY+SDPESHQI+RV++ 
Sbjct:  1187 LFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDT 1246

Query:   299 MDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTN 358
              D+S P+ N E  VGSGERCLPGDEAHCGDGA A+DAKLAYPKG+A+S+DNILYFADGTN
Sbjct:  1247 NDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTN 1306

Query:   359 IRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTLNIEEV 395
             IRMVDRDGIV+T+IGNHMHKSHWKPIPCEGTL +EE+
Sbjct:  1307 IRMVDRDGIVSTLIGNHMHKSHWKPIPCEGTLKLEEM 1343
GO:0005578 "proteinaceous extracellular matrix" evidence=ISS
GO:0007155 "cell adhesion" evidence=ISS;IMP
GO:0005887 "integral to plasma membrane" evidence=IDA
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0042051 "compound eye photoreceptor development" evidence=IMP
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0048058 "compound eye corneal lens development" evidence=IMP
GO:0022416 "chaeta development" evidence=IMP
GO:0045467 "R7 cell development" evidence=IMP
GO:0031005 "filamin binding" evidence=IDA
GO:0008045 "motor neuron axon guidance" evidence=IMP
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0045211 "postsynaptic membrane" evidence=IDA
GO:0016200 "synaptic target attraction" evidence=IMP
GO:0042802 "identical protein binding" evidence=IDA
FB|FBgn0259240 Ten-a "Tenascin accessory" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1LV44 Odz3 "Protein Odz3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU60 LOC100520416 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUQ3 ODZ1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1345183 Tenm3 "teneurin transmembrane protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|K7GQT2 LOC100520416 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5W9 ODZ1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NN19 ODZ1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4B6 ODZ1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O61307TENM_DROMENo assigned EC number0.81100.44810.0790yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 482
KOG4659|consensus 1899 100.0
KOG4659|consensus 1899 100.0
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.96
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.94
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.85
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.61
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.49
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.46
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 99.31
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 99.21
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 99.2
COG3391381 Uncharacterized conserved protein [Function unknow 99.18
KOG1520|consensus376 99.14
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.1
PRK11028330 6-phosphogluconolactonase; Provisional 99.05
PRK11028330 6-phosphogluconolactonase; Provisional 99.03
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.0
COG3391381 Uncharacterized conserved protein [Function unknow 98.97
KOG1214|consensus1289 98.95
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.93
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.89
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.8
KOG1214|consensus1289 98.7
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.61
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.6
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.46
KOG1520|consensus376 98.44
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.36
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.34
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.31
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.31
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.28
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.2
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.19
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.13
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.11
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.05
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 97.97
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.92
KOG4499|consensus310 97.77
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.7
KOG4499|consensus310 97.62
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.58
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.53
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.52
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.47
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 97.34
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.3
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 97.19
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.14
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.1
PF05787524 DUF839: Bacterial protein of unknown function (DUF 97.09
KOG0291|consensus 893 97.01
KOG0318|consensus603 96.3
COG3211616 PhoX Predicted phosphatase [General function predi 96.29
PF13449326 Phytase-like: Esterase-like activity of phytase 96.2
PF05787524 DUF839: Bacterial protein of unknown function (DUF 96.18
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 96.16
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.13
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.0
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.91
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 95.91
KOG1215|consensus 877 95.85
KOG0291|consensus 893 95.78
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 95.67
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 95.6
KOG1446|consensus311 95.41
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.28
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 95.11
PF13449326 Phytase-like: Esterase-like activity of phytase 94.68
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 94.4
PRK02888 635 nitrous-oxide reductase; Validated 94.29
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 93.95
KOG0263|consensus707 93.85
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 93.79
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.75
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 93.74
KOG0266|consensus456 93.6
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 93.56
KOG1274|consensus 933 93.53
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.4
COG3211616 PhoX Predicted phosphatase [General function predi 93.38
PRK04792448 tolB translocation protein TolB; Provisional 93.36
KOG0318|consensus603 93.19
KOG0266|consensus456 92.82
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 92.41
KOG1274|consensus 933 91.87
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 91.46
PRK02888635 nitrous-oxide reductase; Validated 91.06
KOG3567|consensus501 90.33
PRK04922433 tolB translocation protein TolB; Provisional 90.1
KOG1215|consensus877 90.06
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 90.04
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 89.54
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 89.52
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 89.51
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 89.24
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 88.97
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 88.31
PRK03629429 tolB translocation protein TolB; Provisional 88.17
PRK02889427 tolB translocation protein TolB; Provisional 87.6
PRK01742429 tolB translocation protein TolB; Provisional 87.53
KOG1446|consensus311 87.48
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 87.09
COG3823262 Glutamine cyclotransferase [Posttranslational modi 85.13
KOG0279|consensus315 85.12
KOG0272|consensus459 84.23
COG3823262 Glutamine cyclotransferase [Posttranslational modi 83.87
PRK05137435 tolB translocation protein TolB; Provisional 83.49
COG3490366 Uncharacterized protein conserved in bacteria [Fun 82.86
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 82.22
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 82.18
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 81.16
KOG0263|consensus707 80.92
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 80.43
>KOG4659|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.2e-72  Score=592.61  Aligned_cols=416  Identities=32%  Similarity=0.559  Sum_probs=343.7

Q ss_pred             CceEEEEEcCcccCCceEeeeEEEEEEEeeEEcccce-eEEEEEEEEeeccccccccccccccccceecccCCCeEEecC
Q psy8782           1 MIKFTYAWNRLNVYRQRVYGVTTALVKVGYKYRDCRD-IMWDLQTTKLSGHDMSISEIGGWNLDIHHRYNFHEGILQKGD   79 (482)
Q Consensus         1 ~~~~~f~w~~~d~y~~~v~g~~~a~v~vgy~y~~~~~-~~w~~~~~~l~g~~~~~s~~ggw~l~~~h~~~~~~gil~~gd   79 (482)
                      ||+|||+|||+|+|||+|||+++|+|+|||||+.|++ ++||+||++|+|+++++|++|||+||+||+||+.+|||+|||
T Consensus       246 nl~ytfaWdk~n~YrQrv~Gl~~avV~VGyeY~~C~~~ivW~~rt~~l~G~~m~~s~~g~W~LdiHH~ln~~~gIl~kGn  325 (1899)
T KOG4659|consen  246 NLTYTFAWDKMNAYRQRVYGLVPAVVRVGYEYQGCDDTIVWQTRTSQLMGATMRKSIGGGWTLDIHHHLNIVNGILEKGN  325 (1899)
T ss_pred             CcEEEEEecccchhhheeeccceeEEEeeeEecCCCceeeeeeehhhhccccccchhcCcceeecceecccccCeEEecC
Confidence            6899999999999999999999999999999999999 899999999999999999999999999999999999999999


Q ss_pred             CceEEEeeCCCeEEEEeccCccCCCCCcCCCCCCcCcccCCCceEEEEcCCCcEEEEeCCcEEEEcCCCeEEEEEeeCCC
Q psy8782          80 GSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLKNQ  159 (482)
Q Consensus        80 G~~~~~~~~~~~i~tv~G~G~~~~~~~~~~~G~~~~~~~l~~P~glavd~~G~lyvaD~~~Irki~~~G~v~ti~g~g~~  159 (482)
                      |+++++.++|.+|+++||+|.++++.|+.|+|.+ ...+|..|..||..|||.|||.|.|.||||.++|++++++..+..
T Consensus       326 G~n~~it~~Prvitt~mgdG~qR~veC~~C~G~a-~~~~L~aPvala~a~DGSl~VGDfNyIRRI~~dg~v~tIl~L~~t  404 (1899)
T KOG4659|consen  326 GGNRLITEEPRVITTAMGDGHQRDVECPKCEGKA-DSISLFAPVALAYAPDGSLIVGDFNYIRRISQDGQVSTILTLGLT  404 (1899)
T ss_pred             CcceEeecCCceEEEeccCcccccccCCCCCCcc-ccceeeceeeEEEcCCCcEEEccchheeeecCCCceEEEEEecCC
Confidence            9999999999999999999999999999999988 588999999999999999999999999999999999999988643


Q ss_pred             cccCCCccccccccccCC-ceEEEecCCC--eEEE-E-----cCCCeEEEEcCCCccc-cCCCcCCCCC-CCceeecCCc
Q psy8782         160 KFEKFPKILTSCFLSLSP-SGILQKGDGS--NIYL-K-----NKPRIIKTTLGDGHQR-PLDCKDCNGE-AGPKQRLLAP  228 (482)
Q Consensus       160 ~~~~~~~~~~~~~~~~~P-~gi~~~~~g~--~lyi-~-----d~~~~i~~~~g~G~~~-~~~~~~~~g~-~~~~~~l~~P  228 (482)
                      .      ++..+.++.+| +|-+|.++.+  .+|- .     |.......++|+|+.+ |++.. |+++ .+..++|..|
T Consensus       405 ~------~sh~Yy~AvsPvdgtlyvSdp~s~qv~rv~sl~~~d~~~N~evvaG~Ge~Clp~des-CGDGalA~dA~L~~P  477 (1899)
T KOG4659|consen  405 D------TSHSYYIAVSPVDGTLYVSDPLSKQVWRVSSLEPQDSRNNYEVVAGDGEVCLPADES-CGDGALAQDAQLIFP  477 (1899)
T ss_pred             C------ccceeEEEecCcCceEEecCCCcceEEEeccCCccccccCeeEEeccCcCccccccc-cCcchhcccceeccC
Confidence            2      44555555555 3433333221  1221 1     1235677889999874 56555 7665 4688999999


Q ss_pred             cEEEEcCCCCEEEEECCcEEEEcCCCeEEEEEeec----------------cCCCCceeeEEEeCCCCeEEEEeCCCCEE
Q psy8782         229 VALATAPDGSLFVGDFNLIRRIMTDGTVRTVVRLN----------------VTRVAYRYHIAYSPLDGTLYISDPESHQI  292 (482)
Q Consensus       229 ~giavd~~G~lyv~D~~~I~~i~~~G~v~~~~g~~----------------~~~~~~p~giavd~~~g~lyVaD~~n~~I  292 (482)
                      .||++|++|+||++|..+||++|.+|.+.+++|+.                .-++.||..+||+|.++.|||.|  +|-|
T Consensus       478 kGIa~dk~g~lYfaD~t~IR~iD~~giIstlig~~~~~~~p~~C~~~~kl~~~~leWPT~LaV~Pmdnsl~Vld--~nvv  555 (1899)
T KOG4659|consen  478 KGIAFDKMGNLYFADGTRIRVIDTTGIISTLIGTTPDQHPPRTCAQITKLVDLQLEWPTSLAVDPMDNSLLVLD--TNVV  555 (1899)
T ss_pred             CceeEccCCcEEEecccEEEEeccCceEEEeccCCCCccCccccccccchhheeeecccceeecCCCCeEEEee--cceE
Confidence            99999999999999999999999999999999964                23578999999999999999999  7999


Q ss_pred             EEEecCCccCCCCCcEEEEecCCcccCCCCCCccCCCccccccccCCcceEEEeCCCcEEEEECCC-----EEEEcCCCc
Q psy8782         293 LRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADNILYFADGTN-----IRMVDRDGI  367 (482)
Q Consensus       293 ~~~~~~~~~~~~~g~~~~vaG~g~~~~~g~~~~~gdg~~a~~a~l~~P~giavd~~G~lyvaD~~n-----Ir~i~~~G~  367 (482)
                      ++++       +++.+.+++|.+..|.......+-. ..|..+.|-.|..|||..+|.|||+++..     ||++..||+
T Consensus       556 lrit-------~~~rV~Ii~GrP~hC~~a~~t~~~s-kla~H~tl~~~r~Iavg~~G~lyvaEsD~rriNrvr~~~tdg~  627 (1899)
T KOG4659|consen  556 LRIT-------VVHRVRIILGRPTHCDLANATSSAS-KLADHRTLLIQRDIAVGTDGALYVAESDGRRINRVRKLSTDGT  627 (1899)
T ss_pred             EEEc-------cCccEEEEcCCccccccCCCchhhh-hhhhhhhhhhhhceeecCCceEEEEeccchhhhheEEeccCce
Confidence            9999       7999999999999998543222222 46778889999999999999999999854     999999999


Q ss_pred             EEEEEcCCCCCCCCCcCCCCceEEeccccceeEEeecCcceEEecccCCCceEEEeeceeeeeeeeeeecccceeeeeeE
Q psy8782         368 VTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVHFS  447 (482)
Q Consensus       368 i~ti~G~~~~~~~~~~~~~dg~l~v~~~~~~~~~l~~p~giav~~~g~n~~~~~~~~~g~~~~~~~~~~n~~~~~~~~i~  447 (482)
                      |..++|....+..-...-||.             +..-...                          +..+.+.-|..++
T Consensus       628 i~ilaGa~S~C~C~~~~~cdc-------------fs~~~~~--------------------------At~A~lnsp~ala  668 (1899)
T KOG4659|consen  628 ISILAGAKSPCSCDVAACCDC-------------FSLRDVA--------------------------ATQAKLNSPYALA  668 (1899)
T ss_pred             EEEecCCCCCCCcccccCCcc-------------ccccchh--------------------------hhccccCCcceEE
Confidence            999998766543211111221             0000000                          0112233355688


Q ss_pred             EcCCCcEEEEeCCCCeeEEeecccee
Q psy8782         448 HQDQDLFYFVKELPQKIRDDLDELKL  473 (482)
Q Consensus       448 ~~~~g~~yi~d~~n~rIrk~~~~~~~  473 (482)
                      +.++|.+||||..|.||||+.+++--
T Consensus       669 VsPdg~v~IAD~gN~rIr~Vs~~~~~  694 (1899)
T KOG4659|consen  669 VSPDGDVIIADSGNSRIRKVSARMAK  694 (1899)
T ss_pred             ECCCCcEEEecCCchhhhhhhhcccc
Confidence            89999999999999999999887743

>KOG4659|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG3567|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 1e-19
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 2e-19
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-18
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-15
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 4e-14
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 1e-12
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 2e-17
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 6e-15
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 4e-14
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 5e-16
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 3e-11
3kya_A496 Putative phosphatase; structural genomics, joint c 5e-12
3kya_A496 Putative phosphatase; structural genomics, joint c 1e-11
3kya_A 496 Putative phosphatase; structural genomics, joint c 1e-04
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 3e-08
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 1e-05
2p4o_A306 Hypothetical protein; putative lactonase, structur 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 3e-05
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
 Score = 89.8 bits (222), Expect = 1e-19
 Identities = 54/321 (16%), Positives = 96/321 (29%), Gaps = 36/321 (11%)

Query: 66  HRYNFHEGILQKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVAL 125
              N     +   + +  ++  K  ++ T LG  +         +G           V L
Sbjct: 83  SILNDEGEEIANTEANEKFVYQKKMLVTTFLGTMYDGNTKYDLKDGPFDDCGGFGGAVWL 142

Query: 126 ATAPDGS--LFVGDFN-LIRRI-MTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGIL 181
           +  P     L++       R I      V TV    ++        + +   +     ++
Sbjct: 143 SFDPKNHNHLYLVGEQHPTRLIDFEKEYVSTVYSGLSK--------VRTICWTHEADSMI 194

Query: 182 QKGDGSNIYLKNKPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFV 241
              D +N    N   + + +           ++CNG            A     +G L+ 
Sbjct: 195 ITNDQNNNDRPNNYILTRESGFKVITELTKGQNCNG------------AETHPINGELYF 242

Query: 242 GDFN--LIRRIMTDGTVRTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAM 299
             +N   + R        T +   +    + +HI + P     YI     H ILR     
Sbjct: 243 NSWNAGQVFRYDFTTQETTPL-FTIQDSGWEFHIQFHPSGNYAYIVVVNQHYILRSDYDW 301

Query: 300 DFSAPDYNVEPAVGSGERCLPGDEAHCGDGA----PARDAKLAYPKGVAVSADNILYFAD 355
                     P +  G++         G  A    P +   +  P     S +   YF D
Sbjct: 302 KTK---RLTTPYIVCGQQGAKDWVDGVGKKARMHAPRQGTFVKNPAYKGSSDEYDFYFCD 358

Query: 356 GTN--IRMVDRDGIVTTVIGN 374
             N  IR++   G VTT  G 
Sbjct: 359 RENHCIRILTPQGRVTTFAGR 379
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query482
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 100.0
3kya_A496 Putative phosphatase; structural genomics, joint c 100.0
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 100.0
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.98
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.94
3kya_A496 Putative phosphatase; structural genomics, joint c 99.93
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.92
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.92
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.91
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.91
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.9
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.89
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.88
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.88
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.87
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.86
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.86
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.86
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.85
3v65_B386 Low-density lipoprotein receptor-related protein; 99.85
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.85
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.84
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.84
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.84
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.82
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.82
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.82
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.82
3v65_B386 Low-density lipoprotein receptor-related protein; 99.81
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.81
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.81
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.8
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.8
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.79
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.79
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.79
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.76
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.76
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.74
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.73
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.71
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.71
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.7
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.7
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.7
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.69
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.68
2qe8_A343 Uncharacterized protein; structural genomics, join 99.68
2qe8_A343 Uncharacterized protein; structural genomics, join 99.62
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.56
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.55
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.54
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.54
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.54
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.52
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.49
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.47
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.47
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.45
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.45
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.44
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.42
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.4
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.4
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.39
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.37
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.34
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 99.32
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.31
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.31
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.28
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.28
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.26
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.21
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.17
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.12
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.09
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.09
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.07
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.05
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.03
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.01
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.99
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.99
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 98.92
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.91
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.86
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.86
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.84
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.82
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.81
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.78
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.73
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.72
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.69
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.69
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.68
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.67
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.66
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.63
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.61
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.58
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.57
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.56
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.55
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.55
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.52
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.42
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.4
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.4
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.35
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 98.33
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.33
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.32
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.3
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.29
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.22
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.19
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.18
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.12
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.08
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.06
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.05
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.04
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.01
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.0
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.96
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 97.93
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.92
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 97.88
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 97.87
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.85
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.8
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.78
2ece_A462 462AA long hypothetical selenium-binding protein; 97.78
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.76
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.76
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.67
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 97.5
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.42
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.42
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.41
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.3
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.29
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.27
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.27
2ece_A462 462AA long hypothetical selenium-binding protein; 97.19
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.08
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.02
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.98
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 96.92
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.89
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 96.88
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.85
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.85
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.81
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.78
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.76
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.72
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.69
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.68
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.67
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.67
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.66
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.66
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.59
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.54
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.52
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.51
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.51
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.49
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.33
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.32
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.32
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.32
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.27
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.25
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.22
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.22
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.18
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.18
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.17
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.12
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.12
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 96.1
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.08
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.06
3ott_A758 Two-component system sensor histidine kinase; beta 96.04
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 96.03
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.03
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.9
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.77
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.66
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.6
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.6
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.54
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.52
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.48
3ott_A 758 Two-component system sensor histidine kinase; beta 95.44
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.38
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.32
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.29
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.27
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 95.13
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.11
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 94.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.87
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 94.82
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.69
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.67
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.6
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 94.5
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 94.49
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.46
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 94.39
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.3
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.29
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.21
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.15
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 94.03
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.89
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 93.66
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.62
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 93.6
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 93.46
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.21
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 93.07
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 92.99
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 92.93
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 92.56
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 92.49
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 91.61
1k32_A 1045 Tricorn protease; protein degradation, substrate g 91.35
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 91.14
3jrp_A379 Fusion protein of protein transport protein SEC13 91.08
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 91.08
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 90.79
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 90.79
2xyi_A430 Probable histone-binding protein CAF1; transcripti 90.12
1k32_A 1045 Tricorn protease; protein degradation, substrate g 90.07
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 89.99
3jro_A 753 Fusion protein of protein transport protein SEC13 89.38
3jro_A 753 Fusion protein of protein transport protein SEC13 89.35
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 88.59
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 88.5
3jrp_A379 Fusion protein of protein transport protein SEC13 88.43
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 86.8
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 86.77
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 86.66
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 86.45
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 84.76
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 84.33
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 84.28
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 83.1
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 81.61
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 81.2
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 80.82
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 80.54
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 80.47
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 80.37
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 80.36
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
Probab=100.00  E-value=1.6e-32  Score=285.28  Aligned_cols=296  Identities=15%  Similarity=0.133  Sum_probs=219.1

Q ss_pred             ceEEEeeCCCeEEEEec-----cCccCCCCCcCCCCCCcCcccCCCceEEEEcCC---CcEEEEeC-CcEEEEcC-CCeE
Q psy8782          81 SNIYLKNKPRIIKTTLG-----DGHQRPLDCKDCNGEAGPKQRLLAPVALATAPD---GSLFVGDF-NLIRRIMT-DGTV  150 (482)
Q Consensus        81 ~~~~~~~~~~~i~tv~G-----~G~~~~~~~~~~~G~~~~~~~l~~P~glavd~~---G~lyvaD~-~~Irki~~-~G~v  150 (482)
                      +..|.+..+.+|+|++|     +|..+.     ++|..+..++|..|.+|++|++   |+|||+|. ++|+++++ +|.+
T Consensus       100 ~~~F~y~~~~~VsTv~G~~~~~~g~~~~-----~dG~~~~a~~~~~P~gvavd~~s~~g~Lyv~D~~~~I~~id~~~g~v  174 (433)
T 4hw6_A          100 EAKFDYQYNYVVTTFLGKLYENNTKWDV-----LAGPFDDCGAFDNIWRMMFDPNSNYDDLYWVGQRDAFRHVDFVNQYV  174 (433)
T ss_dssp             SSCCEECCCEEEEEEECCCBTTTTBCCC-----CCEETTSCCCCSCCCEEEECTTTTTCEEEEECBTSCEEEEETTTTEE
T ss_pred             eeEEEEEeeeEEeeeecceeccCCCccc-----cCCchHHhcccCCCceEEEccccCCCEEEEEeCCCCEEEEECCCCEE
Confidence            34566778899999999     566553     6777754569999999999984   99999999 99999998 7888


Q ss_pred             EEEEeeCCCcccCCCccccccccccCCceEEEecCCCeEEEEcCCC-----eEEEEcCCCccccCCCcCCCCCCCceeec
Q psy8782         151 RTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKNKPR-----IIKTTLGDGHQRPLDCKDCNGEAGPKQRL  225 (482)
Q Consensus       151 ~ti~g~g~~~~~~~~~~~~~~~~~~~P~gi~~~~~g~~lyi~d~~~-----~i~~~~g~G~~~~~~~~~~~g~~~~~~~l  225 (482)
                      +++++.                 +..|.+++++++++ ||++|..+     .+..+...+...        . ......+
T Consensus       175 ~~~~~~-----------------~~~P~giavd~dG~-lyVad~~~~~~~~gv~~~~~~~~~~--------~-~~~~~~~  227 (433)
T 4hw6_A          175 DIKTTN-----------------IGQCADVNFTLNGD-MVVVDDQSSDTNTGIYLFTRASGFT--------E-RLSLCNA  227 (433)
T ss_dssp             EEECCC-----------------CSCEEEEEECTTCC-EEEEECCSCTTSEEEEEECGGGTTC--------C-EEEEEEC
T ss_pred             EEeecC-----------------CCCccEEEECCCCC-EEEEcCCCCcccceEEEEECCCCee--------c-ccccccc
Confidence            887652                 35699999999997 99998632     222332222111        0 0133578


Q ss_pred             CCccEEEEcC-CCCEEEEEC--CcEEEEcCC-CeE-EEEEeeccCCCCceeeEEEeCCCCeEEEEeCCCCEEEEEecCCc
Q psy8782         226 LAPVALATAP-DGSLFVGDF--NLIRRIMTD-GTV-RTVVRLNVTRVAYRYHIAYSPLDGTLYISDPESHQILRVKNAMD  300 (482)
Q Consensus       226 ~~P~giavd~-~G~lyv~D~--~~I~~i~~~-G~v-~~~~g~~~~~~~~p~giavd~~~g~lyVaD~~n~~I~~~~~~~~  300 (482)
                      ..|.++++|+ +|+|||+|.  ++|++++++ |.+ .+++..+  ....+.+|+++|+++.|||+|..+|+|++++... 
T Consensus       228 ~~P~giavd~~~G~lyv~d~~~~~V~~~d~~~g~~~~~~~~~~--~~~~~~~ia~dpdG~~LYvad~~~~~I~~~~~d~-  304 (433)
T 4hw6_A          228 RGAKTCAVHPQNGKIYYTRYHHAMISSYDPATGTLTEEEVMMD--TKGSNFHIVWHPTGDWAYIIYNGKHCIYRVDYNR-  304 (433)
T ss_dssp             SSBCCCEECTTTCCEEECBTTCSEEEEECTTTCCEEEEEEECS--CCSSCEEEEECTTSSEEEEEETTTTEEEEEEBCT-
T ss_pred             CCCCEEEEeCCCCeEEEEECCCCEEEEEECCCCeEEEEEeccC--CCCCcccEEEeCCCCEEEEEeCCCCEEEEEeCCC-
Confidence            9999999999 899999998  799999997 877 4444332  2345778999994445999999999999998532 


Q ss_pred             cCCCCC---cEEEEecC-CcccCCCCCCccCCCccccccccCCcceEEE---------eCCCcEEEEECCC--EEEEcCC
Q psy8782         301 FSAPDY---NVEPAVGS-GERCLPGDEAHCGDGAPARDAKLAYPKGVAV---------SADNILYFADGTN--IRMVDRD  365 (482)
Q Consensus       301 ~~~~~g---~~~~vaG~-g~~~~~g~~~~~gdg~~a~~a~l~~P~giav---------d~~G~lyvaD~~n--Ir~i~~~  365 (482)
                         ..+   ...+++|. +..      + ..|| ++..++|+.|.||++         |++|+|||||..|  ||+++++
T Consensus       305 ---~~~~~~~~~~~ag~~g~~------g-~~dg-~~~~a~~~~P~giav~~n~~y~~dd~~g~lyvaD~~n~~I~~~~~~  373 (433)
T 4hw6_A          305 ---ETGKLAVPYIVCGQHSSP------G-WVDG-MGTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCDRDSHTVRVLTPE  373 (433)
T ss_dssp             ---TTCCBCCCEEEEECTTCC------C-CBCE-EGGGSBCSSEEEEEEEECGGGTTSSCCEEEEEEETTTTEEEEECTT
T ss_pred             ---CCcccCcEEEEEecCCCC------c-cCCC-cccceEEcCCccEEEEccccccccCCCCcEEEEECCCCEEEEECCC
Confidence               123   34678886 322      1 2244 778899999999999         9999999999987  9999999


Q ss_pred             CcEEEEEcCCCCCCCCCcCCCCceEEeccccceeEEeecCcceEEecccCCCceEEEeeceeeeeeeeeeecccceeeee
Q psy8782         366 GIVTTVIGNHMHKSHWKPIPCEGTLNIEEVSETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFLDVH  445 (482)
Q Consensus       366 G~i~ti~G~~~~~~~~~~~~~dg~l~v~~~~~~~~~l~~p~giav~~~g~n~~~~~~~~~g~~~~~~~~~~n~~~~~~~~  445 (482)
                      |.+++++|.+.....+.   .||.                                            .....++..|.+
T Consensus       374 G~v~t~~G~g~~~~~G~---~dG~--------------------------------------------~~~~~~~~~P~g  406 (433)
T 4hw6_A          374 GRVTTYAGRGNSREWGY---VDGE--------------------------------------------LRSQALFNHPTS  406 (433)
T ss_dssp             SEEEEEECCCTTCSSCC---BCEE--------------------------------------------TTTTCBCSSEEE
T ss_pred             CCEEEEEeCCCCCcccc---CCCc--------------------------------------------cccccEeCCCcE
Confidence            99999999865211000   0110                                            001123445677


Q ss_pred             eEEc-CCCcEEEEeCCCCeeEEeec
Q psy8782         446 FSHQ-DQDLFYFVKELPQKIRDDLD  469 (482)
Q Consensus       446 i~~~-~~g~~yi~d~~n~rIrk~~~  469 (482)
                      |+++ ++|.|||||..||||||+-.
T Consensus       407 iavd~~~g~lyVaD~~n~rIr~i~~  431 (433)
T 4hw6_A          407 IAYDMKRKCFYIGDCDNHRVRKIAP  431 (433)
T ss_dssp             EEEETTTTEEEEEEGGGTEEEEEEE
T ss_pred             EEEECCCCEEEEEeCCCCEEEEEec
Confidence            7888 88999999999999999753
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 482
d1q7fa_ 279 b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D 4e-05
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: NHL repeat
family: NHL repeat
domain: Brain tumor cg10719-pa
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 43.1 bits (100), Expect = 4e-05
 Identities = 19/134 (14%), Positives = 37/134 (27%), Gaps = 10/134 (7%)

Query: 333 RDAKLAYPKGVAVSADNILYFADGTN--IRMVDRDGIVTTVIGNHMHKSHWKPIPCEGTL 390
            + +   P GVAV+A N +  AD  N  I++ D++G      G    +      P    +
Sbjct: 18  MEGQFTEPSGVAVNAQNDIIVADTNNHRIQIFDKEGRFKFQFGECGKRDSQLLYPNRVAV 77

Query: 391 NIEEV--------SETMRDIRHTTGWACYGTGDNDHMTLIHCYGVMQDVVTSVFNNSHFL 442
                              I +  G      G              +  +  V      +
Sbjct: 78  VRNSGDIIVTERSPTHQIQIYNQYGQFVRKFGATILQHPRGVTVDNKGRIIVVECKVMRV 137

Query: 443 DVHFSHQDQDLFYF 456
            +   + +    + 
Sbjct: 138 IIFDQNGNVLHKFG 151

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query482
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.96
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.95
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.91
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.9
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.88
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.85
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.78
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.75
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.71
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.68
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.65
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.64
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.59
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.22
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.98
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.91
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.89
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.87
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.85
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.64
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.43
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.28
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.14
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.12
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.93
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 97.92
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.91
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.78
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.62
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.57
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.53
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.52
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.42
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.35
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.18
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.18
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.08
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.07
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.04
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.89
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.77
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.68
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.36
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.31
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.87
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.44
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.31
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.9
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.22
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.14
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.58
d1tbga_340 beta1-subunit of the signal-transducing G protein 93.32
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.26
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 92.21
d1tbga_340 beta1-subunit of the signal-transducing G protein 91.99
d1tl2a_235 Tachylectin-2 {Japanese horseshoe crab (Tachypleus 90.98
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 90.56
d1tl2a_235 Tachylectin-2 {Japanese horseshoe crab (Tachypleus 87.14
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 87.04
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 86.41
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 84.31
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 83.42
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 82.44
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: NHL repeat
family: NHL repeat
domain: Brain tumor cg10719-pa
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.96  E-value=3.4e-27  Score=228.22  Aligned_cols=242  Identities=14%  Similarity=0.193  Sum_probs=188.0

Q ss_pred             cccCCCceEEEEcCCCcEEEEeC--CcEEEEcCCCeEEEEEeeCCCcccCCCccccccccccCCceEEEecCCCeEEEEc
Q psy8782         116 KQRLLAPVALATAPDGSLFVGDF--NLIRRIMTDGTVRTVVRLKNQKFEKFPKILTSCFLSLSPSGILQKGDGSNIYLKN  193 (482)
Q Consensus       116 ~~~l~~P~glavd~~G~lyvaD~--~~Irki~~~G~v~ti~g~g~~~~~~~~~~~~~~~~~~~P~gi~~~~~g~~lyi~d  193 (482)
                      .++|+.|.+||+|++|+|||+|.  +||++++++|+..+.++....          .......|.++++..+.+..++..
T Consensus        19 ~g~f~~P~gvavd~dg~i~VaD~~n~rI~v~d~~G~~~~~~~~~~~----------~~~~~~~p~~~~~~~~~~~~~~~~   88 (279)
T d1q7fa_          19 EGQFTEPSGVAVNAQNDIIVADTNNHRIQIFDKEGRFKFQFGECGK----------RDSQLLYPNRVAVVRNSGDIIVTE   88 (279)
T ss_dssp             TTCBSCEEEEEECTTCCEEEEEGGGTEEEEECTTSCEEEEECCBSS----------STTCBSSEEEEEEETTTTEEEEEE
T ss_pred             CCeECCccEEEEcCCCCEEEEECCCCEEEEEeCCCCEEEEecccCC----------Ccccccccccccccccccccceec
Confidence            45899999999999999999998  899999999998776644211          112346799999888776666643


Q ss_pred             --CCCeEEEEcCCCccccCCCcCCCCCCCceeecCCccEEEEcCCCCEEEEEC--CcEEEEcCCCeEEEEEeeccCCCCc
Q psy8782         194 --KPRIIKTTLGDGHQRPLDCKDCNGEAGPKQRLLAPVALATAPDGSLFVGDF--NLIRRIMTDGTVRTVVRLNVTRVAY  269 (482)
Q Consensus       194 --~~~~i~~~~g~G~~~~~~~~~~~g~~~~~~~l~~P~giavd~~G~lyv~D~--~~I~~i~~~G~v~~~~g~~~~~~~~  269 (482)
                        .++.+..+..+|......         ....+..|.+++++++|.+|++|.  +++.+++++|++...++. ...+..
T Consensus        89 ~~~~~~i~~~~~~g~~~~~~---------~~~~~~~p~~~avd~~G~i~v~~~~~~~~~~~~~~g~~~~~~g~-~~~~~~  158 (279)
T d1q7fa_          89 RSPTHQIQIYNQYGQFVRKF---------GATILQHPRGVTVDNKGRIIVVECKVMRVIIFDQNGNVLHKFGC-SKHLEF  158 (279)
T ss_dssp             CGGGCEEEEECTTSCEEEEE---------CTTTCSCEEEEEECTTSCEEEEETTTTEEEEECTTSCEEEEEEC-TTTCSS
T ss_pred             cCCccccccccccccceeec---------CCCcccccceeccccCCcEEEEeeccceeeEeccCCceeecccc-cccccc
Confidence              345777776666643210         124567899999999999999999  789999999999887775 456889


Q ss_pred             eeeEEEeCCCCeEEEEeCCCCEEEEEecCCccCCCCCcEEEEecCCcccCCCCCCccCCCccccccccCCcceEEEeCCC
Q psy8782         270 RYHIAYSPLDGTLYISDPESHQILRVKNAMDFSAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGVAVSADN  349 (482)
Q Consensus       270 p~giavd~~~g~lyVaD~~n~~I~~~~~~~~~~~~~g~~~~vaG~g~~~~~g~~~~~gdg~~a~~a~l~~P~giavd~~G  349 (482)
                      |.+|++++ +++|||+|..+++|++++       ++|+.....|.                   ++++..|.|||+|++|
T Consensus       159 ~~~i~~d~-~g~i~v~d~~~~~V~~~d-------~~G~~~~~~g~-------------------~g~~~~P~giavD~~G  211 (279)
T d1q7fa_         159 PNGVVVND-KQEIFISDNRAHCVKVFN-------YEGQYLRQIGG-------------------EGITNYPIGVGINSNG  211 (279)
T ss_dssp             EEEEEECS-SSEEEEEEGGGTEEEEEE-------TTCCEEEEESC-------------------TTTSCSEEEEEECTTC
T ss_pred             cceeeecc-ceeEEeeeccccceeeee-------cCCceeeeecc-------------------cccccCCcccccccCC
Confidence            99999998 899999999999999999       57775443331                   2358899999999999


Q ss_pred             cEEEEECCC---EEEEcCCCcEEEEEcCCC--CCCCCCcCCCCceEEeccccceeEEeec
Q psy8782         350 ILYFADGTN---IRMVDRDGIVTTVIGNHM--HKSHWKPIPCEGTLNIEEVSETMRDIRH  404 (482)
Q Consensus       350 ~lyvaD~~n---Ir~i~~~G~i~ti~G~~~--~~~~~~~~~~dg~l~v~~~~~~~~~l~~  404 (482)
                      +|||||..+   |++++++|++...++...  ..+...+++.||.||+++..++|+.+.+
T Consensus       212 ~i~Vad~~~~~~v~~f~~~G~~~~~~~~~~~~~~p~~vav~~dG~l~V~~~n~~v~~fr~  271 (279)
T d1q7fa_         212 EILIADNHNNFNLTIFTQDGQLISALESKVKHAQCFDVALMDDGSVVLASKDYRLYIYRY  271 (279)
T ss_dssp             CEEEEECSSSCEEEEECTTSCEEEEEEESSCCSCEEEEEEETTTEEEEEETTTEEEEEEC
T ss_pred             eEEEEECCCCcEEEEECCCCCEEEEEeCCCCCCCEeEEEEeCCCcEEEEeCCCeEEEEEe
Confidence            999999754   889999999654443332  2344566778999999887778877766
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure