Diaphorina citri psyllid: psy8783


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKRLGSMFNITTHETATDGKELRLQKAHSEA
ccccEEEEEccCEEEEEEEECcccEEEEEEEcccccccccHHHHHHHccccEEEEEEcccccCEEEEEcccccc
*QDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKRLGSMFNITTH******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDVVTSVFNNSHFLDVHFSHQDQDLFYFVKELPQKIRDDLDELKRLGSMFNITTHETATDGKELRLQKAHSEA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Teneurin-m Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Acts as a homophilic and heterophilic synaptic cell adhesion molecule that drives synapse assembly. Promotes bi-directional trans-synaptic signaling with ten-a to organize neuromuscular synapses. Function in olfactory synaptic partner matching; promotes homophilic cell adhesion between pre-synaptic olfactory receptor neurons (ORN) axons and post-synaptic projection neurons (PN) dendrites partner in the developing antennal lobe to form stable connections. Also required for peripheral axon growth cone guidance and target recognition of motor neurons.confidentO61307

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0031005 [MF]filamin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted