Psyllid ID: psy8786


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480----
MFKMGVMMTMLVVLMFLTLKSVAIGSLLLFIATVSVLSRIKYWLSPSSPPVVTPVTTFSSSPVNAFVSPVNAFASPVNAFASPLRNAVLQSEAGDGNGSNIHVHIHMNESQGMHWGTSSHIPDPASSYPPMVPMPDHTYAQNPYPYPPARDTYLHPPSGASMWSRQGVDGPLSITGIVNGSVDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLRQLREPVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLMEDCVSERQLTDMMYEFME
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHcccHHHHHHHHHHcccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccccHHHHHHHccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHccccccccEEEEEEcccccccccccHHHHHHcccccccHHHHHHHHHHHHc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEcccEEccccccccEEccHcccccHHHHcccHHHHHHHHccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccEEEEcccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHHHHHHHEEEEEEEEEEcccHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHccEEEEEEcccEccccccccccccHHccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHEEEEEEEEEEcccHHHHHccccHHHHHHHccccccHHHHHHHHHHHcc
MFKMGVMMTMLVVLMFLTLKSVAIGSLLLFIATVSVLSRIKywlspssppvvtpvttfssspvnafvspvnafaspvnafasplrNAVLqseagdgngsniHVHIHMnesqgmhwgtsshipdpassyppmvpmpdhtyaqnpypyppardtylhppsgasmwsrqgvdgplsitgivngsvdpserVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNlsssaghlsqITNLELKKRLRQLrepvslrslnitkehprahvakgwpdsayAVSKIGVNLLTRIYQKkfdcelgnqdkvinavHPGYvatnmssfmgnvnifddsstfNAFERVISHFLIgqqintfipaiytvpfAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNlsssaghlsqITNLELKKRLMEDCVSERQLTDMMYEFME
MFKMGVMMTMLVVLMFLTLKSVAIGSLLLFIATVSVLSRIKYWLSPSSPPVVTPVTTFSSSPVNAFVSPVNAFASPVNAFASPLRNAVLQSEAGDGNGSNIHVHIHMNESQGMHWGTSSHIPDPASSYPPMVPMPDHTYAQNPYPYPPARDTYLHPPSGASMWSRQGVDGPLSITGIVNGSVDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNlsssaghlsqitnlELKKRLRQLREpvslrslnitkehprahvakgwpdsaYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVvnlsssaghlsqitnlelkkrLMEDCVSERQLTDMMYEFME
MFKMGvmmtmlvvlmfltlKSVAIGSLLLFIATVSVLSRIKYWLspssppvvtpvttfssspvNAFVSPVNAFASPVNAFASPLRNAVLQSEAGDGNGSNIHVHIHMNESQGMHWGTSSHIPDPASSYPPMVPMPDHTYAQNPYPYPPARDTYLHPPSGASMWSRQGVDGPLSITGIVNGSVDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNlelkkrlrqlrePVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLMEDCVSERQLTDMMYEFME
***MGVMMTMLVVLMFLTLKSVAIGSLLLFIATVSVLSRIKYWLSPSSPPVVTPVTTFSSSPVNAFVSPVNAFASPVNAFASPLR****************HVHI**************************************************************VDGPLSITGIVNGSVDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLR*L***VSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLMEDCV**************
****GVMMTMLVVLMFLTLKSVAIGSLLLFIATVSVLSRIKYWLSPSSPPVVTPVTTFSSSPVNAFVSPVNAFASPVNAFASPLRNAV**********SNIHVHIHMNESQGMHWGTSSHIPDPASSYPPMVP*************P***********************************DPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLRQLREPVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAG***********KRLMEDCVSERQLTDMMYEFME
MFKMGVMMTMLVVLMFLTLKSVAIGSLLLFIATVSVLSRIKYWLSPSSPPVVTPVTTFSSSPVNAFVSPVNAFASPVNAFASPLRNAVLQSEAGDGNGSNIHVHIHMNESQGMHWGTSSHIPDPASSYPPMVPMPDHTYAQNPYPYPPARDTYLHPPSGASMWSRQGVDGPLSITGIVNGSVDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLRQLREPVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLMEDCVSERQLTDMMYEFME
*FKMGVMMTMLVVLMFLTLKSVAIGSLLLFIATVSVLSRIKYWLSPSSPPVVTPVTTFSSSPVNAFVSPVNAFASPVNAFASPLRNAVLQSEAGDGNGSNIHVHIHMNESQ**HWGTSSHIPDPASSYPPMVPMPDHTYAQNPYPYPPARDTYLHPPSGASMWSRQGVDGPLSITGIVNGSVDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLRQLREPVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLMEDCVSERQLTDMMYEFME
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKMGVMMTMLVVLMFLTLKSVAIGSLLLFIATVSVLSRIKYWLSPSSPPVVTPVTTFSSSPVNAFVSPVNAFASPVNAFASPLRNAVLQSEAGDGNGSNIHVHIHMNESQGMHWGTSSHIPDPASSYPPMVPMPDHTYAQNPYPYPPARDTYLHPPSGASMWSRQGVDGPLSITGIVNGSVDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLRQLREPVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAGHLSQITNLELKKRLMEDCVSERQLTDMMYEFME
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query484 2.2.26 [Sep-21-2011]
Q8K354277 Carbonyl reductase [NADPH yes N/A 0.400 0.700 0.348 2e-28
Q28960289 Carbonyl reductase [NADPH no N/A 0.376 0.629 0.334 9e-27
P48758277 Carbonyl reductase [NADPH no N/A 0.380 0.664 0.331 3e-26
P47844277 Carbonyl reductase [NADPH no N/A 0.384 0.671 0.330 1e-25
Q3SZD7277 Carbonyl reductase [NADPH no N/A 0.359 0.628 0.355 2e-25
Q8MI29277 Carbonyl reductase [NADPH N/A N/A 0.378 0.660 0.336 7e-25
P16152277 Carbonyl reductase [NADPH yes N/A 0.373 0.653 0.331 3e-24
Q5RCU5277 Carbonyl reductase [NADPH yes N/A 0.373 0.653 0.331 4e-24
P47727277 Carbonyl reductase [NADPH no N/A 0.376 0.657 0.341 7e-24
O75828277 Carbonyl reductase [NADPH no N/A 0.373 0.653 0.318 6e-22
>sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=2 SV=1 Back     alignment and function desciption
 Score =  127 bits (319), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/247 (34%), Positives = 120/247 (48%), Gaps = 53/247 (21%)

Query: 187 RVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLK-------------D 233
           RVA+VTGANKG+GF I + LC +F G + LTARD+ +G  AVQ L+             D
Sbjct: 6   RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEGLSPRFHQLDID 65

Query: 234 RASTV-------------------------------PFAIQAEKTILTNYLGLVRTCVFL 262
              ++                               PF IQAE T+ TN+      C  L
Sbjct: 66  DPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDIQAEVTLKTNFFATRNVCTEL 125

Query: 263 FPLLRRHARVVNLSSSAGHLSQITN----LELKKRLRQLREP--VSLRSLNITKEHPRAH 316
            P+++ H RVVN+SS  G L  + N    L+ K R   L E   V L    +       H
Sbjct: 126 LPIMKPHGRVVNISSLQG-LKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEVH 184

Query: 317 VAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKV-INAVHPGYVATNMSSFMGNVN 375
             +GWPDSAY VSK+GV +LTRI  ++ D E    D++ +NA  PG+V T+M+   G+  
Sbjct: 185 EREGWPDSAYGVSKLGVTVLTRILARQLD-EKRKADRILLNACCPGWVKTDMARDQGSRT 243

Query: 376 IFDDSST 382
           + + + T
Sbjct: 244 VEEGAET 250




Has low NADPH-dependent oxidoreductase activity towards 4-benzoylpyridine and menadione (in vitro).
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 8EC: 4
>sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 Back     alignment and function description
>sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 Back     alignment and function description
>sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 Back     alignment and function description
>sp|Q3SZD7|CBR1_BOVIN Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1 Back     alignment and function description
>sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 Back     alignment and function description
>sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 Back     alignment and function description
>sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 Back     alignment and function description
>sp|P47727|CBR1_RAT Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus GN=Cbr1 PE=1 SV=2 Back     alignment and function description
>sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query484
340719469276 PREDICTED: carbonyl reductase [NADPH] 1- 0.386 0.677 0.402 5e-39
307200580274 Carbonyl reductase [NADPH] 1 [Harpegnath 0.390 0.689 0.428 8e-39
350410469276 PREDICTED: carbonyl reductase [NADPH] 1- 0.386 0.677 0.398 9e-39
383863073276 PREDICTED: carbonyl reductase [NADPH] 1- 0.386 0.677 0.389 2e-38
442749421277 Putative 20-hydroxysteroid dehydrogenase 0.386 0.675 0.423 5e-38
427787661277 Putative 20-hydroxysteroid dehydrogenase 0.386 0.675 0.432 5e-38
91083531282 PREDICTED: similar to predicted protein 0.388 0.666 0.406 1e-37
380029301271 PREDICTED: carbonyl reductase [NADPH] 1- 0.382 0.682 0.407 3e-37
332372658282 unknown [Dendroctonus ponderosae] 0.380 0.652 0.390 2e-36
346471833277 hypothetical protein [Amblyomma maculatu 0.386 0.675 0.423 3e-36
>gi|340719469|ref|XP_003398176.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  168 bits (426), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 129/236 (54%), Gaps = 49/236 (20%)

Query: 187 RVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRA----------- 235
           RVAVVTG NKG+GF IVK LC+QFDG +YLTARD  +G  A++ L+ +            
Sbjct: 3   RVAVVTGGNKGIGFAIVKHLCKQFDGVVYLTARDVTRGQNAIKELEKQGLKPKFHQLDIT 62

Query: 236 ---------------------------------STVPFAIQAEKTILTNYLGLVRTCVFL 262
                                            +T PF++QAE+T+  NY  L + C  L
Sbjct: 63  DESSISTFHDYLEKTYQGLDVLVNNAAIAFKTTATEPFSLQAEETLRVNYFSLRKVCSKL 122

Query: 263 FPLLRRHARVVNLSSSAGHLSQITNLELKKRLRQ----LREPVSLRSLNITKEHPRAHVA 318
           +PLL+ HARVV++SSSAGHLS+I    LKKR         E  ++    I       H+ 
Sbjct: 123 YPLLKTHARVVHVSSSAGHLSKIPGETLKKRFSDPNLTEEELDNIMHEFIDAAKTNTHLQ 182

Query: 319 KGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGNV 374
           KGW +SAY  SK+GV+ L RI+Q+ F+ +   +D V+NAVHPGYV T+M+S  G +
Sbjct: 183 KGWANSAYVASKVGVSALARIHQRMFNSDT-REDLVVNAVHPGYVDTDMTSHKGTL 237




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|307200580|gb|EFN80721.1| Carbonyl reductase [NADPH] 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350410469|ref|XP_003489050.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383863073|ref|XP_003707007.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|442749421|gb|JAA66870.1| Putative 20-hydroxysteroid dehydrogenase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|427787661|gb|JAA59282.1| Putative 20-hydroxysteroid dehydrogenase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|91083531|ref|XP_973193.1| PREDICTED: similar to predicted protein [Tribolium castaneum] gi|270010851|gb|EFA07299.1| hypothetical protein TcasGA2_TC014539 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380029301|ref|XP_003698315.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Apis florea] Back     alignment and taxonomy information
>gi|332372658|gb|AEE61471.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|346471833|gb|AEO35761.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query484
MGI|MGI:1309992277 Cbr3 "carbonyl reductase 3" [M 0.295 0.516 0.353 3.2e-29
UNIPROTKB|F1SGX4277 CBR3 "Uncharacterized protein" 0.274 0.480 0.357 6.9e-29
RGD|1309728277 Cbr3 "carbonyl reductase 3" [R 0.295 0.516 0.34 8.4e-29
UNIPROTKB|Q3SZD7277 CBR1 "Carbonyl reductase [NADP 0.274 0.480 0.376 1.1e-28
RGD|2286277 Cbr1 "carbonyl reductase 1" [R 0.266 0.465 0.375 3.7e-27
UNIPROTKB|F1N8Y3276 CBR1 "Uncharacterized protein" 0.268 0.471 0.362 1.3e-26
UNIPROTKB|F1P2X1277 CBR1 "Uncharacterized protein" 0.268 0.469 0.362 1.7e-26
UNIPROTKB|G1K231277 LOC100335345 "Uncharacterized 0.274 0.480 0.369 2.7e-26
UNIPROTKB|Q0VC97277 CBR3 "Carbonyl reductase 3" [B 0.295 0.516 0.32 6.7e-26
UNIPROTKB|J9P7P2277 CBR1 "Uncharacterized protein" 0.266 0.465 0.382 3e-25
MGI|MGI:1309992 Cbr3 "carbonyl reductase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 211 (79.3 bits), Expect = 3.2e-29, Sum P(2) = 3.2e-29
 Identities = 53/150 (35%), Positives = 75/150 (50%)

Query:   239 PFAIQAEKTILTNYLGLVRTCVFLFPLLRRHARVVNLSSSAG--HLSQITNXXXXXXXXX 296
             PF IQAE T+ TN+      C  L P+++ H RVVN+SS  G   L              
Sbjct:   102 PFDIQAEVTLKTNFFATRNVCTELLPIMKPHGRVVNISSLQGLKALENCREDLQEKFRCD 161

Query:   297 XXXPVSLRSLN---ITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDK 353
                 V L  L    +       H  +GWPDSAY VSK+GV +LTRI  ++ D E    D+
Sbjct:   162 TLTEVDLVDLMKKFVEDTKNEVHEREGWPDSAYGVSKLGVTVLTRILARQLD-EKRKADR 220

Query:   354 VI-NAVHPGYVATNMSSFMGNVNIFDDSST 382
             ++ NA  PG+V T+M+   G+  + + + T
Sbjct:   221 ILLNACCPGWVKTDMARDQGSRTVEEGAET 250


GO:0000166 "nucleotide binding" evidence=IEA
GO:0000253 "3-keto sterol reductase activity" evidence=ISO
GO:0004090 "carbonyl reductase (NADPH) activity" evidence=ISO
GO:0005737 "cytoplasm" evidence=IEA
GO:0005829 "cytosol" evidence=ISO
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0042376 "phylloquinone catabolic process" evidence=ISO
GO:0055114 "oxidation-reduction process" evidence=ISO
GO:0070402 "NADPH binding" evidence=ISO
UNIPROTKB|F1SGX4 CBR3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1309728 Cbr3 "carbonyl reductase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZD7 CBR1 "Carbonyl reductase [NADPH] 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|2286 Cbr1 "carbonyl reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8Y3 CBR1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2X1 CBR1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K231 LOC100335345 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VC97 CBR3 "Carbonyl reductase 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7P2 CBR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 3e-39
cd05233234 cd05233, SDR_c, classical (c) SDRs 2e-13
COG1028251 COG1028, FabG, Dehydrogenases with different speci 3e-13
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 7e-11
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 2e-09
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 2e-08
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 5e-08
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 6e-08
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 4e-07
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 8e-07
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 2e-06
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 8e-06
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 1e-05
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 1e-05
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 1e-05
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 1e-05
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 1e-05
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 2e-05
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 3e-05
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-05
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 6e-05
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-05
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 8e-05
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-05
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 1e-04
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 1e-04
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 1e-04
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 1e-04
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-04
PRK06197306 PRK06197, PRK06197, short chain dehydrogenase; Pro 4e-04
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 4e-04
cd09763265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 5e-04
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 6e-04
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 7e-04
cd08941290 cd08941, 3KS_SDR_c, 3-keto steroid reductase, clas 8e-04
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 8e-04
PRK06924251 PRK06924, PRK06924, short chain dehydrogenase; Pro 0.001
PRK05854313 PRK05854, PRK05854, short chain dehydrogenase; Pro 0.001
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 0.002
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.002
cd05328250 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid de 0.003
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 0.003
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 0.004
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 0.004
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 0.004
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
 Score =  141 bits (357), Expect = 3e-39
 Identities = 64/231 (27%), Positives = 91/231 (39%), Gaps = 93/231 (40%)

Query: 187 RVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLK-------------- 232
           +VA+VTGAN+G+GF IV+ L +   G + LTARD ++G  AV+ L+              
Sbjct: 1   KVALVTGANRGIGFEIVRQLAKSGPGTVILTARDVERGQAAVEKLRAEGLSVRFHQLDVT 60

Query: 233 DRAS-------------------------------TVPFAIQAEKTILTNYLGLVRTCVF 261
           D AS                               + P   QA +T+ TN+ G V     
Sbjct: 61  DDASIEAAADFVEEKYGGLDILVNNAGIAFKGFDDSTPTREQARETMKTNFFGTVDVTQA 120

Query: 262 LFPLLRR--HARVVNLSSSAGHLSQITNLELKKRLRQLREPVSLRSLNITKEHPRAHVAK 319
           L PLL++    R+VN+SS  G L+                                    
Sbjct: 121 LLPLLKKSPAGRIVNVSSGLGSLT------------------------------------ 144

Query: 320 GWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKV-INAVHPGYVATNMSS 369
               SAY VSK  +N LTRI  K+       +  + +NA  PG+V T+M  
Sbjct: 145 ----SAYGVSKAALNALTRILAKEL-----KETGIKVNACCPGWVKTDMGG 186


PTCR is a classical SDR which catalyzes the NADPH-dependent reduction of ketones on steroids and prostaglandins. Unlike most SDRs, PTCR functions as a monomer. This subgroup also includes human carbonyl reductase 1 (CBR1) and CBR3. CBR1 is an NADPH-dependent SDR with broad substrate specificity and may be responsible for the in vivo reduction of quinones, prostaglandins, and other carbonyl-containing compounds. In addition it includes poppy NADPH-dependent salutaridine reductase which catalyzes the stereospecific reduction of salutaridine to 7(S)-salutaridinol in the biosynthesis of morphine, and Arabidopsis SDR1,a menthone reductase, which catalyzes the reduction of menthone to neomenthol, a compound with antimicrobial activity; SDR1 can also carry out neomenthol oxidation. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 225

>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187645 cd08941, 3KS_SDR_c, 3-keto steroid reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235627 PRK05854, PRK05854, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187589 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid dehydrogenase (3alpha_HSD), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 484
KOG1200|consensus256 99.98
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.96
PRK08339263 short chain dehydrogenase; Provisional 99.96
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.96
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.96
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.96
KOG0725|consensus270 99.96
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.96
PRK05867253 short chain dehydrogenase; Provisional 99.96
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.96
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.96
PRK07063260 short chain dehydrogenase; Provisional 99.96
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.96
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.95
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.95
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.95
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.95
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.95
PRK12747252 short chain dehydrogenase; Provisional 99.95
PRK07062265 short chain dehydrogenase; Provisional 99.95
PRK07478254 short chain dehydrogenase; Provisional 99.95
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.95
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.95
PRK08265261 short chain dehydrogenase; Provisional 99.95
PRK07791286 short chain dehydrogenase; Provisional 99.95
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.95
PRK08589272 short chain dehydrogenase; Validated 99.95
PRK06128300 oxidoreductase; Provisional 99.95
PRK06114254 short chain dehydrogenase; Provisional 99.95
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.94
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.94
COG0300265 DltE Short-chain dehydrogenases of various substra 99.94
PRK07985294 oxidoreductase; Provisional 99.94
PRK05884223 short chain dehydrogenase; Provisional 99.94
PRK08277278 D-mannonate oxidoreductase; Provisional 99.94
PRK06125259 short chain dehydrogenase; Provisional 99.94
PRK06940275 short chain dehydrogenase; Provisional 99.94
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.94
PRK08303305 short chain dehydrogenase; Provisional 99.94
PRK07035252 short chain dehydrogenase; Provisional 99.94
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.94
KOG1207|consensus245 99.94
PRK06172253 short chain dehydrogenase; Provisional 99.94
PRK12742237 oxidoreductase; Provisional 99.93
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.93
PRK08340259 glucose-1-dehydrogenase; Provisional 99.93
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK06484520 short chain dehydrogenase; Validated 99.93
PRK06398258 aldose dehydrogenase; Validated 99.93
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.93
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.93
PRK06523260 short chain dehydrogenase; Provisional 99.93
PLN02253280 xanthoxin dehydrogenase 99.93
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.93
PRK07831262 short chain dehydrogenase; Provisional 99.93
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.93
PRK06701290 short chain dehydrogenase; Provisional 99.92
KOG1205|consensus282 99.92
PRK08936261 glucose-1-dehydrogenase; Provisional 99.92
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.92
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.92
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.92
PRK09242257 tropinone reductase; Provisional 99.92
KOG1201|consensus300 99.92
PRK06949258 short chain dehydrogenase; Provisional 99.92
PRK06841255 short chain dehydrogenase; Provisional 99.92
PRK08643256 acetoin reductase; Validated 99.92
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.92
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.92
PRK07856252 short chain dehydrogenase; Provisional 99.92
PRK05854313 short chain dehydrogenase; Provisional 99.92
PRK06196315 oxidoreductase; Provisional 99.92
PRK08862227 short chain dehydrogenase; Provisional 99.92
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.92
PRK07067257 sorbitol dehydrogenase; Provisional 99.92
PRK05717255 oxidoreductase; Validated 99.92
PRK05872296 short chain dehydrogenase; Provisional 99.91
PRK06500249 short chain dehydrogenase; Provisional 99.91
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK07677252 short chain dehydrogenase; Provisional 99.91
PRK08628258 short chain dehydrogenase; Provisional 99.91
PRK08703239 short chain dehydrogenase; Provisional 99.91
PRK07576264 short chain dehydrogenase; Provisional 99.91
PRK06483236 dihydromonapterin reductase; Provisional 99.91
PRK12743256 oxidoreductase; Provisional 99.91
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.91
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK08226263 short chain dehydrogenase; Provisional 99.91
PRK06139330 short chain dehydrogenase; Provisional 99.91
PRK08278273 short chain dehydrogenase; Provisional 99.91
PRK12744257 short chain dehydrogenase; Provisional 99.9
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.9
PRK12939250 short chain dehydrogenase; Provisional 99.9
PLN00015308 protochlorophyllide reductase 99.9
PRK07890258 short chain dehydrogenase; Provisional 99.9
PRK06484 520 short chain dehydrogenase; Validated 99.9
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.9
PLN02780320 ketoreductase/ oxidoreductase 99.9
PRK05599246 hypothetical protein; Provisional 99.9
PRK06057255 short chain dehydrogenase; Provisional 99.9
PRK06197306 short chain dehydrogenase; Provisional 99.9
KOG1208|consensus314 99.9
PRK07060245 short chain dehydrogenase; Provisional 99.9
PRK12937245 short chain dehydrogenase; Provisional 99.9
PRK07814263 short chain dehydrogenase; Provisional 99.9
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.89
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.89
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.89
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.89
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.89
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.89
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.89
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.89
PRK09186256 flagellin modification protein A; Provisional 99.89
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.89
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.89
PRK05876275 short chain dehydrogenase; Provisional 99.89
PRK07109334 short chain dehydrogenase; Provisional 99.88
PRK07825273 short chain dehydrogenase; Provisional 99.88
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.88
PRK06138252 short chain dehydrogenase; Provisional 99.88
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.88
PRK05875276 short chain dehydrogenase; Provisional 99.88
PRK07577234 short chain dehydrogenase; Provisional 99.88
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.88
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.88
KOG1611|consensus249 99.88
PRK06947248 glucose-1-dehydrogenase; Provisional 99.87
PRK07904253 short chain dehydrogenase; Provisional 99.87
PRK05866293 short chain dehydrogenase; Provisional 99.87
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.87
PRK07069251 short chain dehydrogenase; Validated 99.87
PRK07774250 short chain dehydrogenase; Provisional 99.87
KOG4169|consensus261 99.87
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.87
PRK06182273 short chain dehydrogenase; Validated 99.87
PRK06123248 short chain dehydrogenase; Provisional 99.87
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.87
PRK07578199 short chain dehydrogenase; Provisional 99.87
PRK06198260 short chain dehydrogenase; Provisional 99.87
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.87
PRK05855582 short chain dehydrogenase; Validated 99.87
PRK07832272 short chain dehydrogenase; Provisional 99.86
PRK12746254 short chain dehydrogenase; Provisional 99.86
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.86
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.86
PRK06101240 short chain dehydrogenase; Provisional 99.86
PRK09009235 C factor cell-cell signaling protein; Provisional 99.86
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.86
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK07074257 short chain dehydrogenase; Provisional 99.86
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.86
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK09072263 short chain dehydrogenase; Provisional 99.86
PRK12828239 short chain dehydrogenase; Provisional 99.85
PRK05993277 short chain dehydrogenase; Provisional 99.85
PRK07454241 short chain dehydrogenase; Provisional 99.85
PRK07024257 short chain dehydrogenase; Provisional 99.85
PRK06180277 short chain dehydrogenase; Provisional 99.85
PRK06924251 short chain dehydrogenase; Provisional 99.85
COG1028251 FabG Dehydrogenases with different specificities ( 99.85
PRK08263275 short chain dehydrogenase; Provisional 99.85
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.85
KOG1199|consensus260 99.84
PRK07102243 short chain dehydrogenase; Provisional 99.84
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
PRK12827249 short chain dehydrogenase; Provisional 99.84
PRK06194287 hypothetical protein; Provisional 99.84
PRK10538248 malonic semialdehyde reductase; Provisional 99.84
PRK07806248 short chain dehydrogenase; Provisional 99.84
PRK12367245 short chain dehydrogenase; Provisional 99.84
PRK05650270 short chain dehydrogenase; Provisional 99.84
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
PRK09134258 short chain dehydrogenase; Provisional 99.84
PRK07041230 short chain dehydrogenase; Provisional 99.83
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.83
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.83
PRK06179270 short chain dehydrogenase; Provisional 99.83
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.83
PRK05693274 short chain dehydrogenase; Provisional 99.83
PRK08251248 short chain dehydrogenase; Provisional 99.83
PRK07201657 short chain dehydrogenase; Provisional 99.82
PRK08324681 short chain dehydrogenase; Validated 99.82
PRK06914280 short chain dehydrogenase; Provisional 99.82
PRK08267260 short chain dehydrogenase; Provisional 99.82
KOG1610|consensus322 99.82
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.82
PRK08177225 short chain dehydrogenase; Provisional 99.81
PRK07326237 short chain dehydrogenase; Provisional 99.81
PRK06181263 short chain dehydrogenase; Provisional 99.81
KOG1209|consensus289 99.8
PRK07775274 short chain dehydrogenase; Provisional 99.8
KOG1014|consensus312 99.8
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.8
PRK12829264 short chain dehydrogenase; Provisional 99.8
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.79
PRK06482276 short chain dehydrogenase; Provisional 99.79
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.79
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.78
PRK09135249 pteridine reductase; Provisional 99.78
PRK08264238 short chain dehydrogenase; Validated 99.78
PRK07023243 short chain dehydrogenase; Provisional 99.77
PRK06953222 short chain dehydrogenase; Provisional 99.77
PRK09291257 short chain dehydrogenase; Provisional 99.77
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.76
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.74
PRK08017256 oxidoreductase; Provisional 99.74
KOG1210|consensus331 99.74
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.73
PRK08219227 short chain dehydrogenase; Provisional 99.68
KOG1204|consensus253 99.66
KOG1478|consensus341 99.62
PLN03209 576 translocon at the inner envelope of chloroplast su 99.56
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.52
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.45
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.37
PLN02583297 cinnamoyl-CoA reductase 99.36
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.35
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.28
KOG1502|consensus327 99.15
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.15
PLN02653340 GDP-mannose 4,6-dehydratase 99.13
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.12
PLN02650351 dihydroflavonol-4-reductase 99.11
PLN00198338 anthocyanidin reductase; Provisional 99.09
PLN02572442 UDP-sulfoquinovose synthase 99.06
PLN02214342 cinnamoyl-CoA reductase 99.02
PLN02896353 cinnamyl-alcohol dehydrogenase 99.02
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 98.99
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 98.99
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 98.98
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 98.97
PLN02240352 UDP-glucose 4-epimerase 98.95
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.92
PLN02686367 cinnamoyl-CoA reductase 98.88
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 98.88
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 98.86
TIGR01746367 Thioester-redct thioester reductase domain. It has 98.84
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 98.84
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 98.83
PRK06720169 hypothetical protein; Provisional 98.83
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 98.8
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 98.75
PRK10675338 UDP-galactose-4-epimerase; Provisional 98.74
PLN02427386 UDP-apiose/xylose synthase 98.72
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 98.72
KOG4022|consensus236 98.72
PLN02206442 UDP-glucuronate decarboxylase 98.67
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 98.67
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.65
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 98.61
PLN02166436 dTDP-glucose 4,6-dehydratase 98.58
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.56
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.54
PRK11908347 NAD-dependent epimerase/dehydratase family protein 98.54
PLN02695370 GDP-D-mannose-3',5'-epimerase 98.54
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.51
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.51
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 98.5
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.48
PLN02260 668 probable rhamnose biosynthetic enzyme 98.43
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.43
PLN02778298 3,5-epimerase/4-reductase 98.41
KOG1429|consensus350 98.41
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 98.39
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.33
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.32
COG3320382 Putative dehydrogenase domain of multifunctional n 98.27
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.25
KOG1371|consensus343 98.15
PF08643299 DUF1776: Fungal family of unknown function (DUF177 98.15
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.13
PLN02996 491 fatty acyl-CoA reductase 98.11
CHL00194317 ycf39 Ycf39; Provisional 98.08
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.06
PRK07201 657 short chain dehydrogenase; Provisional 98.01
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.0
PLN02503 605 fatty acyl-CoA reductase 2 97.86
KOG1430|consensus361 97.85
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 97.82
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 97.8
PLN02260668 probable rhamnose biosynthetic enzyme 97.77
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 97.71
COG4982 866 3-oxoacyl-[acyl-carrier protein] 97.4
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.37
PRK05865 854 hypothetical protein; Provisional 97.32
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 97.32
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.28
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 97.26
KOG0747|consensus331 97.21
KOG1610|consensus 322 97.12
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.06
KOG1221|consensus 467 97.06
PRK14982340 acyl-ACP reductase; Provisional 96.96
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 96.75
PRK08309177 short chain dehydrogenase; Provisional 96.74
PLN00016378 RNA-binding protein; Provisional 96.7
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.67
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.61
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 96.46
PRK12320 699 hypothetical protein; Provisional 96.4
KOG1203|consensus411 96.38
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.21
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 96.18
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.16
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.16
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.16
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.14
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.01
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 95.79
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 95.78
KOG1431|consensus315 95.74
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 95.71
PRK09620229 hypothetical protein; Provisional 95.39
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 95.36
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.3
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 95.3
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 95.27
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 95.26
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 95.18
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.18
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.07
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 95.04
PRK08306296 dipicolinate synthase subunit A; Reviewed 94.89
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 94.86
PRK12549284 shikimate 5-dehydrogenase; Reviewed 94.81
PRK14027283 quinate/shikimate dehydrogenase; Provisional 94.76
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 94.65
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 94.64
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 94.52
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 94.23
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 94.15
COG2130340 Putative NADP-dependent oxidoreductases [General f 94.15
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.01
PRK13940414 glutamyl-tRNA reductase; Provisional 94.01
KOG0023|consensus360 93.93
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 93.9
PTZ00075476 Adenosylhomocysteinase; Provisional 93.82
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 93.71
PLN00106323 malate dehydrogenase 93.66
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 93.51
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 93.49
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 93.49
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 93.4
PLN02494477 adenosylhomocysteinase 93.36
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 93.35
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 93.28
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 93.22
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 93.06
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 92.95
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 92.9
PRK08655 437 prephenate dehydrogenase; Provisional 92.88
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 92.83
PRK06849389 hypothetical protein; Provisional 92.76
PRK12550272 shikimate 5-dehydrogenase; Reviewed 92.71
KOG1202|consensus 2376 92.68
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 92.52
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.47
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 92.39
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 92.32
KOG2774|consensus366 92.32
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 92.26
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 92.19
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 92.14
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 92.1
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 92.06
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 91.88
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 91.73
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 91.61
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 91.55
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 91.38
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 91.36
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 91.19
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 91.14
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 91.06
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 90.99
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.97
PTZ00325321 malate dehydrogenase; Provisional 90.93
KOG4039|consensus238 90.92
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 90.81
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 90.79
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 90.75
PLN02586360 probable cinnamyl alcohol dehydrogenase 90.74
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 90.71
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 90.6
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.37
PRK06732229 phosphopantothenate--cysteine ligase; Validated 90.3
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.28
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 90.19
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 90.1
PLN00203519 glutamyl-tRNA reductase 90.08
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.07
PRK06718202 precorrin-2 dehydrogenase; Reviewed 90.03
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.0
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 89.93
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 89.91
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 89.88
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 89.79
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 89.73
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 89.68
PRK06719157 precorrin-2 dehydrogenase; Validated 89.56
PLN02178375 cinnamyl-alcohol dehydrogenase 89.27
KOG2865|consensus391 89.26
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 89.21
PRK12480330 D-lactate dehydrogenase; Provisional 89.17
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 89.13
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.83
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.8
KOG0069|consensus336 88.79
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 88.7
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.14
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.12
PLN02827378 Alcohol dehydrogenase-like 88.11
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.09
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 88.05
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 88.0
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 87.98
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 87.97
PLN03139386 formate dehydrogenase; Provisional 87.96
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 87.8
PRK07574385 formate dehydrogenase; Provisional 87.78
PRK06932314 glycerate dehydrogenase; Provisional 87.77
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 87.73
COG0569225 TrkA K+ transport systems, NAD-binding component [ 87.66
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 87.49
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.45
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 87.36
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.22
PRK06487317 glycerate dehydrogenase; Provisional 87.17
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 87.12
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.03
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 86.86
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 86.78
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 86.71
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 86.64
PLN00112444 malate dehydrogenase (NADP); Provisional 86.4
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 86.32
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.07
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 86.04
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.02
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 85.7
PRK04148134 hypothetical protein; Provisional 85.7
PLN02514357 cinnamyl-alcohol dehydrogenase 85.6
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.49
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 85.41
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 85.33
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.06
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.03
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.01
KOG1372|consensus376 84.94
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 84.74
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.64
PRK06436303 glycerate dehydrogenase; Provisional 84.58
PF12076164 Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 84.52
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 84.43
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 84.33
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 84.32
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.3
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 84.28
PLN02306386 hydroxypyruvate reductase 84.27
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.25
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.08
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 84.07
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.06
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.02
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 84.01
PRK14968188 putative methyltransferase; Provisional 83.96
KOG1197|consensus336 83.96
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 83.95
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 83.84
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 83.81
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 83.8
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 83.78
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 83.73
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 83.61
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 83.59
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 83.57
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 83.45
PTZ00354334 alcohol dehydrogenase; Provisional 83.4
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.34
KOG1196|consensus343 83.33
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.21
PRK08328231 hypothetical protein; Provisional 83.18
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 82.99
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 82.98
PRK05442326 malate dehydrogenase; Provisional 82.97
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 82.87
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.81
COG2085211 Predicted dinucleotide-binding enzymes [General fu 82.74
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 82.7
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 82.68
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 82.63
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 82.57
PTZ00117319 malate dehydrogenase; Provisional 82.26
KOG1198|consensus347 82.14
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 82.14
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 82.1
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 81.97
PLN02740381 Alcohol dehydrogenase-like 81.64
>KOG1200|consensus Back     alignment and domain information
Probab=99.98  E-value=1.4e-32  Score=250.39  Aligned_cols=182  Identities=20%  Similarity=0.233  Sum_probs=156.3

Q ss_pred             CCCCCEEEEEcCCchHHHHHHHHHHhcCCCeEEEEecCchhHHHHHHHHHhc----------------------------
Q psy8786         183 DPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDR----------------------------  234 (484)
Q Consensus       183 ~L~gKvaLITGassGIG~aiA~~La~~gga~Vvl~~R~~~~~~~~~~~l~~~----------------------------  234 (484)
                      .+..|+++||||++|||++++..|+++ |++|++++++...+++++..+...                            
T Consensus        11 r~~sk~~~vtGg~sGIGrAia~~la~~-Garv~v~dl~~~~A~ata~~L~g~~~h~aF~~DVS~a~~v~~~l~e~~k~~g   89 (256)
T KOG1200|consen   11 RLMSKVAAVTGGSSGIGRAIAQLLAKK-GARVAVADLDSAAAEATAGDLGGYGDHSAFSCDVSKAHDVQNTLEEMEKSLG   89 (256)
T ss_pred             HHhcceeEEecCCchHHHHHHHHHHhc-CcEEEEeecchhhHHHHHhhcCCCCccceeeeccCcHHHHHHHHHHHHHhcC
Confidence            357799999999999999999999999 999999999988888877777652                            


Q ss_pred             ---------------CCCCccHHHHHHHHHhhhHHHHHHHHHHHHhh--hc--CCEEEEEeCCCccccccchHHHHHHHh
Q psy8786         235 ---------------ASTVPFAIQAEKTILTNYLGLVRTCVFLFPLL--RR--HARVVNLSSSAGHLSQITNLELKKRLR  295 (484)
Q Consensus       235 ---------------~~~~~~~~~~~~~~~vN~~g~~~l~~allp~l--~~--~grIV~iSS~ag~~~~~~~~~~~~~~~  295 (484)
                                     .......++|+..+.+|+.|.|.++|++...|  .+  +.+|||+||+.|.....          
T Consensus        90 ~psvlVncAGItrD~~Llrmkq~qwd~vi~vNL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGkiGN~----------  159 (256)
T KOG1200|consen   90 TPSVLVNCAGITRDGLLLRMKQEQWDSVIAVNLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKIGNF----------  159 (256)
T ss_pred             CCcEEEEcCccccccceeeccHHHHHHHHHhhchhhHHHHHHHHHHHHHhcCCCceEEeehhhhcccccc----------
Confidence                           11123458999999999999999999999874  22  24999999999843322          


Q ss_pred             hccccccccccccccCCCcccccCCCCChhhHHhHHHHHHHHHHHHHHhhhhcCCCCeEEEEEeCCcccCCCccCCCC--
Q psy8786         296 QLREPVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMGN--  373 (484)
Q Consensus       296 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~aSKaAl~~lt~~LA~ela~~~~~~gIrVNaV~PG~V~T~m~~~~~~--  373 (484)
                                                ++..|++||+++.+|+|+.|+|++++    |||||+|+||+|.|||+...++  
T Consensus       160 --------------------------GQtnYAAsK~GvIgftktaArEla~k----nIrvN~VlPGFI~tpMT~~mp~~v  209 (256)
T KOG1200|consen  160 --------------------------GQTNYAASKGGVIGFTKTAARELARK----NIRVNVVLPGFIATPMTEAMPPKV  209 (256)
T ss_pred             --------------------------cchhhhhhcCceeeeeHHHHHHHhhc----CceEeEeccccccChhhhhcCHHH
Confidence                                      23889999999999999999999998    9999999999999999988765  


Q ss_pred             -------------CCHHhHHHHHHHHHhhhcccccccccccccccee
Q psy8786         374 -------------VNIFDDSSTFNAFERVISHFLIGQQINTFIPAIY  407 (484)
Q Consensus       374 -------------~~peevA~~~~~L~s~~a~~itG~~i~~~~~g~~  407 (484)
                                   +++||+|+.++||+|+.++|+||+.+  .++|++
T Consensus       210 ~~ki~~~iPmgr~G~~EevA~~V~fLAS~~ssYiTG~t~--evtGGl  254 (256)
T KOG1200|consen  210 LDKILGMIPMGRLGEAEEVANLVLFLASDASSYITGTTL--EVTGGL  254 (256)
T ss_pred             HHHHHccCCccccCCHHHHHHHHHHHhccccccccceeE--EEeccc
Confidence                         89999999999999999999999998  556554



>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG4039|consensus Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
1n5d_A288 Crystal Structure Of Porcine Testicular Carbonyl Re 1e-26
1n5d_A 288 Crystal Structure Of Porcine Testicular Carbonyl Re 1e-08
1wma_A276 Crystal Structure Of Human Cbr1 In Complex With Hyd 1e-23
1wma_A276 Crystal Structure Of Human Cbr1 In Complex With Hyd 3e-07
2hrb_A274 Crystal Structure Of Human Carbonyl Reductase 3, Co 4e-23
2hrb_A274 Crystal Structure Of Human Carbonyl Reductase 3, Co 2e-06
2pfg_A276 Crystal Structure Of Human Cbr1 In Complex With Big 3e-22
2pfg_A276 Crystal Structure Of Human Cbr1 In Complex With Big 7e-06
3o26_A311 The Structure Of Salutaridine Reductase From Papave 9e-05
1yo6_A250 Crystal Structure Of The Putative Carbonyl Reductas 2e-04
>pdb|1N5D|A Chain A, Crystal Structure Of Porcine Testicular Carbonyl Reductase 20beta-Hydroxysteroid Dehydrogenase Length = 288 Back     alignment and structure

Iteration: 1

Score = 117 bits (293), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 75/230 (32%), Positives = 103/230 (44%), Gaps = 49/230 (21%) Query: 187 RVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRA----------- 235 RVA+VTGANKG+GF IV+ LC QF G + LTARD +G AV+ L+ Sbjct: 5 RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRFHQLDII 64 Query: 236 ---------------------------------STVPFAIQAEKTILTNYLGLVRTCVFL 262 + PF IQAE T+ TN++G C L Sbjct: 65 DLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTEL 124 Query: 263 FPLLRRHARVVNLSSSAG-----HLSQITNXXXXXXXXXXXXPVSLRSLNITKEHPRAHV 317 PL++ RVVN+SS+ G S V L + + H Sbjct: 125 LPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHR 184 Query: 318 AKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNM 367 +GW DS Y V+KIGV++L+RIY +K + ++NA PG+V T+M Sbjct: 185 KEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDM 234
>pdb|1N5D|A Chain A, Crystal Structure Of Porcine Testicular Carbonyl Reductase 20beta-Hydroxysteroid Dehydrogenase Length = 288 Back     alignment and structure
>pdb|1WMA|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Hydroxy-pp Length = 276 Back     alignment and structure
>pdb|1WMA|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Hydroxy-pp Length = 276 Back     alignment and structure
>pdb|2HRB|A Chain A, Crystal Structure Of Human Carbonyl Reductase 3, Complexed With Nadp+ Length = 274 Back     alignment and structure
>pdb|2HRB|A Chain A, Crystal Structure Of Human Carbonyl Reductase 3, Complexed With Nadp+ Length = 274 Back     alignment and structure
>pdb|2PFG|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Bigf2 Length = 276 Back     alignment and structure
>pdb|2PFG|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Bigf2 Length = 276 Back     alignment and structure
>pdb|3O26|A Chain A, The Structure Of Salutaridine Reductase From Papaver Somniferum Length = 311 Back     alignment and structure
>pdb|1YO6|A Chain A, Crystal Structure Of The Putative Carbonyl Reductase Sniffer Of Caenorhabditis Elegans Length = 250 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 4e-55
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 5e-13
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 3e-26
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 5e-14
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 4e-09
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 3e-19
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 4e-14
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 2e-13
4eso_A255 Putative oxidoreductase; NADP, structural genomics 4e-13
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 1e-12
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 2e-12
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 4e-12
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 6e-12
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 7e-12
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 4e-11
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 1e-10
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 2e-10
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 2e-10
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 6e-10
1xq1_A266 Putative tropinone reducatse; structural genomics, 7e-10
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 1e-09
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 2e-09
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 3e-09
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 4e-09
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 5e-09
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 5e-09
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 9e-09
4e4y_A244 Short chain dehydrogenase family protein; structur 1e-08
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 1e-08
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 1e-08
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-08
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-08
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 3e-08
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 4e-08
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 4e-08
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 5e-08
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 5e-08
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 6e-08
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 7e-08
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 8e-08
1spx_A278 Short-chain reductase family member (5L265); paral 1e-07
3cxt_A291 Dehydrogenase with different specificities; rossma 1e-07
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 1e-07
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 1e-07
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 1e-07
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 2e-07
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 3e-07
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 3e-07
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 3e-07
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 5e-07
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 5e-07
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 9e-07
3gem_A260 Short chain dehydrogenase; structural genomics, AP 9e-07
1xkq_A280 Short-chain reductase family member (5D234); parra 9e-07
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 1e-06
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 1e-06
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 1e-06
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 2e-06
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 2e-06
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 2e-06
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 2e-06
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 2e-06
3tjr_A301 Short chain dehydrogenase; structural genomics, se 3e-06
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 3e-06
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 3e-06
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 3e-06
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 4e-06
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 4e-06
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 4e-06
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 6e-06
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 7e-06
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 9e-06
3tsc_A277 Putative oxidoreductase; structural genomics, seat 9e-06
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 9e-06
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 1e-05
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 1e-05
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 1e-05
1xhl_A297 Short-chain dehydrogenase/reductase family member 1e-05
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 1e-05
1nff_A260 Putative oxidoreductase RV2002; directed evolution 1e-05
1ooe_A236 Dihydropteridine reductase; structural genomics, P 2e-05
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 2e-05
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 2e-05
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 2e-05
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 2e-05
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 3e-05
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 3e-05
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 3e-05
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 3e-05
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 4e-05
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 4e-05
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 5e-05
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 5e-05
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 7e-05
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 7e-05
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 8e-05
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 9e-05
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 9e-05
3tox_A280 Short chain dehydrogenase; structural genomics, PS 1e-04
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 1e-04
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 1e-04
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 1e-04
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 1e-04
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 1e-04
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 2e-04
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 2e-04
4dqx_A277 Probable oxidoreductase protein; structural genomi 2e-04
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 2e-04
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 2e-04
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 2e-04
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 3e-04
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3rih_A293 Short chain dehydrogenase or reductase; structural 3e-04
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 3e-04
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 4e-04
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 4e-04
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 4e-04
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 4e-04
3e03_A274 Short chain dehydrogenase; structural genomics, PS 4e-04
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 5e-04
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 5e-04
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 5e-04
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 5e-04
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 5e-04
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 5e-04
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 6e-04
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 6e-04
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 6e-04
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 6e-04
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 6e-04
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 6e-04
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 6e-04
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 6e-04
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 6e-04
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 8e-04
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 8e-04
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 9e-04
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 9e-04
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
 Score =  184 bits (470), Expect = 4e-55
 Identities = 74/237 (31%), Positives = 104/237 (43%), Gaps = 49/237 (20%)

Query: 185 SERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLK------------ 232
              VA+VTG NKG+G  IV+ LC  F G + LTARD  +G  AVQ L+            
Sbjct: 3   GIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLD 62

Query: 233 --DRAS------------------------------TVPFAIQAEKTILTNYLGLVRTCV 260
             D  S                                PF IQAE T+ TN+ G    C 
Sbjct: 63  IDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCT 122

Query: 261 FLFPLLRRHARVVNLSSSAGHLSQITNLELKK---RLRQLREPVSLRSLNITKEHPRA-- 315
            L PL++   RVVN+SS     +  +     +   R   + E   +  +N   E  +   
Sbjct: 123 ELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGV 182

Query: 316 HVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMG 372
           H  +GWP SAY V+KIGV +L+RI+ +K   +      ++NA  PG+V T+M+    
Sbjct: 183 HQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA 239


>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query484
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.98
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.98
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.97
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.97
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.97
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.97
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.97
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.97
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.97
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.97
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.97
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.97
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.97
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.97
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.97
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.97
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.97
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.97
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.97
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.97
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.97
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.97
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.97
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.97
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.97
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.97
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.97
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.97
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.97
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.97
3rih_A293 Short chain dehydrogenase or reductase; structural 99.97
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.97
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.97
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.97
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.97
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.97
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.97
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.97
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.97
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.97
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.97
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.97
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.97
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.97
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.97
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.97
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.97
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.97
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.97
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.97
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.97
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.97
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.97
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.96
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.96
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.96
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.96
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.96
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.96
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.96
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.96
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.96
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.96
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.96
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.96
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.96
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.96
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.96
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.96
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.96
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.96
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.96
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.96
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.96
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.96
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.96
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.96
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.96
4e4y_A244 Short chain dehydrogenase family protein; structur 99.96
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.96
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.96
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.96
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.96
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.96
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.96
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.96
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.96
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.96
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.96
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.96
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.96
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.96
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.96
3cxt_A291 Dehydrogenase with different specificities; rossma 99.96
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.96
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.96
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.96
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.96
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.96
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.96
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.96
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.96
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.96
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.96
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.96
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.96
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.96
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.96
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.96
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.96
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.96
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.95
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.95
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.95
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.95
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.95
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.95
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.95
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.95
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.95
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.95
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.95
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.95
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.95
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.95
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.95
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.95
1xkq_A280 Short-chain reductase family member (5D234); parra 99.95
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.95
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.95
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.95
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.95
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.95
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.95
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.95
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.95
1spx_A278 Short-chain reductase family member (5L265); paral 99.95
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.95
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.95
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.95
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.95
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.95
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.95
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.95
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.95
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.95
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.95
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.95
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.94
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.94
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.94
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.94
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.94
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.94
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.94
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.94
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.94
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.94
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.94
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.94
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.94
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.94
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.94
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.94
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.94
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.94
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.94
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.94
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.94
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.94
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.93
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.93
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.93
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.93
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.93
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.93
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.93
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.93
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.93
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.93
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.93
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.93
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.93
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.93
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.93
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.93
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.93
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.93
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.93
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.92
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.92
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.92
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.92
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.91
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.91
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.91
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.91
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.91
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.91
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.91
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.9
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.89
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.88
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.86
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.86
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.83
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.83
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.83
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.82
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.76
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.75
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.72
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.68
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.68
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.67
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.63
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.61
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.6
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.6
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.58
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.58
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.58
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.57
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.53
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.51
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.51
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.5
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.5
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.5
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.49
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.48
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.48
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.47
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.46
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.46
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.45
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.45
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.44
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.44
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.44
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.43
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.42
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.42
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.42
1xq6_A253 Unknown protein; structural genomics, protein stru 99.41
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.41
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.41
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.4
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.4
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.38
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.37
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.37
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.37
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.36
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.36
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.35
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.34
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.34
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.34
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.31
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.31
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.3
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.3
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.3
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.3
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.29
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.29
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.29
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.25
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.24
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.23
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.22
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.22
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.21
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.2
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.19
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.19
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.19
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.18
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.18
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.18
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.16
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.14
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.14
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.13
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.13
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.13
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.09
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.08
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.03
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.03
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 98.97
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 98.95
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 98.94
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 98.92
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 98.91
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.85
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.84
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.72
3ius_A286 Uncharacterized conserved protein; APC63810, silic 98.7
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.62
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.58
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.58
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 98.51
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 98.38
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.26
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.1
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.09
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.93
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 97.74
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.65
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.51
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.46
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.43
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.43
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.4
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.37
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.35
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.33
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.31
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.29
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.26
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 97.25
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.2
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.19
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.18
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.09
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.06
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 97.04
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 97.02
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.98
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.97
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 96.93
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.93
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.92
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 96.88
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.85
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.82
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.76
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 96.72
3fbg_A346 Putative arginate lyase; structural genomics, unkn 96.71
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 96.7
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.49
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 96.48
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 96.41
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 96.24
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.24
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.22
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.05
3krt_A456 Crotonyl COA reductase; structural genomics, prote 96.03
4eye_A342 Probable oxidoreductase; structural genomics, niai 95.97
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 95.94
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.83
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.81
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 95.8
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 95.78
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 95.72
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 95.72
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 95.6
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.52
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.5
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.49
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 95.46
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.42
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.4
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 95.19
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.17
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 95.17
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 95.08
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 95.06
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.05
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 94.92
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 94.91
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 94.89
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.89
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 94.81
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.8
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 94.73
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 94.72
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 94.71
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 94.7
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 94.7
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.64
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 94.58
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.55
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 94.44
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 94.42
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 94.4
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 94.37
3tl2_A315 Malate dehydrogenase; center for structural genomi 94.28
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 94.26
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 94.23
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 94.21
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.18
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.1
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 94.03
3p2o_A285 Bifunctional protein fold; structural genomics, ce 93.99
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 93.91
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 93.84
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 93.81
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 93.77
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 93.64
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 93.57
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 93.52
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 93.51
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 93.51
2rir_A300 Dipicolinate synthase, A chain; structural genomic 93.44
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 93.36
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.19
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 93.04
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 93.02
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.96
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 92.92
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 92.85
3c85_A183 Putative glutathione-regulated potassium-efflux S 92.81
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 92.73
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 92.62
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.56
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 92.47
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 92.46
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 92.32
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 92.21
3l07_A285 Bifunctional protein fold; structural genomics, ID 92.19
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 92.1
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.08
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 91.97
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 91.97
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 91.94
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 91.81
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 91.66
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 91.65
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 91.48
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 91.43
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 91.39
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 91.35
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 91.29
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 91.24
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 91.21
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.04
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 91.02
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 91.02
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 91.01
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 90.9
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 90.87
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 90.83
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 90.8
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 90.6
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 90.55
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 90.49
3l6d_A306 Putative oxidoreductase; structural genomics, prot 90.13
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 90.11
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 90.08
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 90.08
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 89.99
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 89.91
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 89.91
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 89.84
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 89.8
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 89.8
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 89.68
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 89.57
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 89.52
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.41
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 89.33
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 89.29
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 89.18
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 88.92
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 88.72
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 88.67
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 88.67
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 88.58
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 88.39
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 88.04
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 87.82
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 87.8
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.66
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 87.64
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 87.61
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 87.33
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 87.29
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 87.16
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 86.97
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 86.43
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 86.36
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 85.99
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 85.96
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 85.79
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 85.67
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 85.61
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 85.57
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 85.38
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=100.00  E-value=8.1e-39  Score=313.08  Aligned_cols=184  Identities=22%  Similarity=0.218  Sum_probs=162.3

Q ss_pred             CCCCCCEEEEEcCCchHHHHHHHHHHhcCCCeEEEEecCchhHHHHHHHHHhc---------------------------
Q psy8786         182 VDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDR---------------------------  234 (484)
Q Consensus       182 ~~L~gKvaLITGassGIG~aiA~~La~~gga~Vvl~~R~~~~~~~~~~~l~~~---------------------------  234 (484)
                      +||+||++|||||++|||+++|++|+++ |++|++++|++++++++.++++..                           
T Consensus         3 ~sL~gKvalVTGas~GIG~aiA~~la~~-Ga~Vv~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~   81 (254)
T 4fn4_A            3 QSLKNKVVIVTGAGSGIGRAIAKKFALN-DSIVVAVELLEDRLNQIVQELRGMGKEVLGVKADVSKKKDVEEFVRRTFET   81 (254)
T ss_dssp             GGGTTCEEEEETTTSHHHHHHHHHHHHT-TCEEEEEESCHHHHHHHHHHHHHTTCCEEEEECCTTSHHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEeCCCCHHHHHHHHHHHHc-CCEEEEEECCHHHHHHHHHHHHhcCCcEEEEEccCCCHHHHHHHHHHHHHH
Confidence            4789999999999999999999999999 999999999999999988888653                           


Q ss_pred             -----------C-------CCCccHHHHHHHHHhhhHHHHHHHHHHHHhhhc--CCEEEEEeCCCcc-ccccchHHHHHH
Q psy8786         235 -----------A-------STVPFAIQAEKTILTNYLGLVRTCVFLFPLLRR--HARVVNLSSSAGH-LSQITNLELKKR  293 (484)
Q Consensus       235 -----------~-------~~~~~~~~~~~~~~vN~~g~~~l~~allp~l~~--~grIV~iSS~ag~-~~~~~~~~~~~~  293 (484)
                                 +       ..+.+.++|++++++|+.|+|+++|+++|+|++  +|+|||+||.++. +.+..       
T Consensus        82 ~G~iDiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~~~~~~-------  154 (254)
T 4fn4_A           82 YSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAG-------  154 (254)
T ss_dssp             HSCCCEEEECCCCCCTTCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGTCSSSSC-------
T ss_pred             cCCCCEEEECCcccCCCCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCcEEEEEechhhcCCCCCC-------
Confidence                       1       112345899999999999999999999999965  5899999999984 33332       


Q ss_pred             HhhccccccccccccccCCCcccccCCCCChhhHHhHHHHHHHHHHHHHHhhhhcCCCCeEEEEEeCCcccCCCccCCC-
Q psy8786         294 LRQLREPVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMG-  372 (484)
Q Consensus       294 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~aSKaAl~~lt~~LA~ela~~~~~~gIrVNaV~PG~V~T~m~~~~~-  372 (484)
                                                    .+|++||+|+.+|||+||.||+++    |||||+|+||+|+|+|..... 
T Consensus       155 ------------------------------~~Y~asKaal~~ltr~lA~ela~~----gIrVN~V~PG~i~T~~~~~~~~  200 (254)
T 4fn4_A          155 ------------------------------APYTVAKHGLIGLTRSIAAHYGDQ----GIRAVAVLPGTVKTNIGLGSSK  200 (254)
T ss_dssp             ------------------------------HHHHHHHHHHHHHHHHHHHHHGGG----TEEEEEEEECSBCSSCTTSCSS
T ss_pred             ------------------------------hHHHHHHHHHHHHHHHHHHHhhhh----CeEEEEEEeCCCCCcccccccC
Confidence                                          789999999999999999999998    999999999999999865432 


Q ss_pred             ------------------CCCHHhHHHHHHHHHhhhccccccccccccccceeec
Q psy8786         373 ------------------NVNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYTV  409 (484)
Q Consensus       373 ------------------~~~peevA~~~~~L~s~~a~~itG~~i~~~~~g~~~~  409 (484)
                                        .++|||+|+.++||+|+.++|+||+.|  .+||+|++
T Consensus       201 ~~~~~~~~~~~~~~~~~R~g~pediA~~v~fLaSd~a~~iTG~~i--~VDGG~t~  253 (254)
T 4fn4_A          201 PSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFVNGDAV--VVDGGLTV  253 (254)
T ss_dssp             CCHHHHHHHHHHHTTCCCCBCHHHHHHHHHHHHSGGGTTCCSCEE--EESTTGGG
T ss_pred             CcHHHHHHHHhcCCCCCCCcCHHHHHHHHHHHhCchhcCCcCCEE--EeCCCccc
Confidence                              168999999999999999999999999  88999864



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 484
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 9e-26
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 1e-14
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 5e-13
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 5e-13
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 8e-12
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 8e-12
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 1e-11
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 1e-11
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 1e-11
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 3e-11
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 4e-11
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 7e-11
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 1e-10
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 1e-10
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 1e-10
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 2e-10
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 2e-10
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 3e-10
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 3e-10
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 4e-10
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 4e-10
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 5e-10
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 5e-10
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 5e-10
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 9e-10
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 1e-09
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-09
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-09
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-09
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 3e-09
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 4e-09
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 4e-09
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 6e-09
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 8e-09
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 8e-09
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 1e-08
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 1e-08
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 1e-08
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 2e-08
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 2e-08
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 5e-08
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 5e-08
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 5e-08
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 6e-08
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 8e-08
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 3e-07
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-07
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-07
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 7e-07
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 8e-07
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 9e-07
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 1e-06
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 1e-06
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-06
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-06
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 4e-06
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-05
d2h7ma1268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 2e-04
d1e7wa_284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-04
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 4e-04
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 4e-04
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 0.001
d1d7oa_297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 0.004
d2pd4a1274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 0.004
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Carbonyl reductase/20beta-hydroxysteroid dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  104 bits (259), Expect = 9e-26
 Identities = 71/235 (30%), Positives = 102/235 (43%), Gaps = 49/235 (20%)

Query: 187 RVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDRASTV-------- 238
            VA+VTG NKG+G  IV+ LC  F G + LTARD  +G  AVQ L+    +         
Sbjct: 4   HVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDID 63

Query: 239 ------------------------------------PFAIQAEKTILTNYLGLVRTCVFL 262
                                               PF IQAE T+ TN+ G    C  L
Sbjct: 64  DLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTEL 123

Query: 263 FPLLRRHARVVNLSSSAGHLSQITNLELKKRLRQLR-----EPVSLRSLNITKEHPRAHV 317
            PL++   RVVN+SS     +  +     ++  +       E V L +  +       H 
Sbjct: 124 LPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQ 183

Query: 318 AKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFMG 372
            +GWP SAY V+KIGV +L+RI+ +K   +      ++NA  PG+V T+M+    
Sbjct: 184 KEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA 238


>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query484
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.97
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.97
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.97
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.97
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.97
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.97
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.97
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.97
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.96
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.96
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.96
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.96
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.96
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.95
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.95
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.95
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.95
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.95
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.95
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.94
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.79
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.3
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.25
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.22
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.22
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.18
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.14
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.11
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.01
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.99
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.92
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.91
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.85
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.84
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 98.84
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.83
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.77
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.75
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.72
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.72
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.69
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.67
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.66
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.55
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.44
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.43
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.42
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.4
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.12
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.06
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.02
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.95
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 97.59
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.89
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.79
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 96.62
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.61
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 96.41
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.38
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.34
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.23
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.18
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.09
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.07
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.05
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.9
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 95.89
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.83
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.75
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 95.64
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.54
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.53
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.52
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.51
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.44
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.35
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.11
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.04
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.89
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.88
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.82
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.69
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.66
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.47
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.28
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.18
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.13
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.13
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.03
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.95
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 93.72
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 93.51
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.48
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 93.4
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 93.34
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.33
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.24
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 93.06
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 93.03
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.99
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.82
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.79
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.71
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.69
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.47
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 92.34
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 91.98
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.9
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.88
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 91.65
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 91.26
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 90.57
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 90.56
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.2
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.97
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 89.88
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 89.79
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.65
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 89.39
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 89.26
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.17
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 88.47
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 88.3
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 88.18
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 87.76
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 87.57
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 87.13
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 86.23
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 85.25
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 85.2
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 84.86
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 84.67
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 84.29
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 83.81
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 82.41
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 81.18
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 81.15
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 80.89
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 80.13
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: beta-keto acyl carrier protein reductase
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]
Probab=100.00  E-value=1.6e-37  Score=301.58  Aligned_cols=186  Identities=22%  Similarity=0.220  Sum_probs=160.6

Q ss_pred             CCCCCCCCCEEEEEcCCchHHHHHHHHHHhcCCCeEEEEecCchhHHHHHHHHHhc------------------------
Q psy8786         179 NGSVDPSERVAVVTGANKGLGFGIVKSLCEQFDGYIYLTARDKKKGAEAVQVLKDR------------------------  234 (484)
Q Consensus       179 ~~~~~L~gKvaLITGassGIG~aiA~~La~~gga~Vvl~~R~~~~~~~~~~~l~~~------------------------  234 (484)
                      |+.++|+||+||||||++|||+++|++|+++ |++|++++|++++++++.++++..                        
T Consensus         3 n~~f~lenKvalITGas~GIG~a~a~~la~~-Ga~V~~~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~~~~~~   81 (251)
T d2c07a1           3 NYYYCGENKVALVTGAGRGIGREIAKMLAKS-VSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKI   81 (251)
T ss_dssp             CCCCCCSSCEEEEESTTSHHHHHHHHHHTTT-SSEEEEEESSHHHHHHHHHHHHTTTCCEEEEECCTTCHHHHHHHHHHH
T ss_pred             ccccCCCCCEEEEeCCCCHHHHHHHHHHHHc-CCEEEEEECCHHHHHHHHHHHHhcCCcEEEEEccCCCHHHHHHHHHHH
Confidence            4458899999999999999999999999999 899999999999999888888653                        


Q ss_pred             --------------------CCCCccHHHHHHHHHhhhHHHHHHHHHHHHhhhc--CCEEEEEeCCCcc-ccccchHHHH
Q psy8786         235 --------------------ASTVPFAIQAEKTILTNYLGLVRTCVFLFPLLRR--HARVVNLSSSAGH-LSQITNLELK  291 (484)
Q Consensus       235 --------------------~~~~~~~~~~~~~~~vN~~g~~~l~~allp~l~~--~grIV~iSS~ag~-~~~~~~~~~~  291 (484)
                                          .......++|++++++|+.++++++++++|+|++  +|+|||+||.++. +.+..     
T Consensus        82 ~~~~g~iDilvnnag~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~-----  156 (251)
T d2c07a1          82 LTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQ-----  156 (251)
T ss_dssp             HHHCSCCCEEEECCCCCCCCCTTTCCHHHHHHHHHHHTTHHHHHHHHHHHHHHHHTCEEEEEECCTHHHHCCTTC-----
T ss_pred             HHhcCCceeeeeccccccccccccccHHHHhhhheeeehhhhhhhhhcCcccccCCCeEEEEECCHHhcCCCCCC-----
Confidence                                2233456899999999999999999999999965  5899999999883 33332     


Q ss_pred             HHHhhccccccccccccccCCCcccccCCCCChhhHHhHHHHHHHHHHHHHHhhhhcCCCCeEEEEEeCCcccCCCccCC
Q psy8786         292 KRLRQLREPVSLRSLNITKEHPRAHVAKGWPDSAYAVSKIGVNLLTRIYQKKFDCELGNQDKVINAVHPGYVATNMSSFM  371 (484)
Q Consensus       292 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~aSKaAl~~lt~~LA~ela~~~~~~gIrVNaV~PG~V~T~m~~~~  371 (484)
                                                      .+|++||+|+++|+|+||+||+++    |||||+|+||+|+|+|....
T Consensus       157 --------------------------------~~Y~asKaal~~ltr~lA~el~~~----gIrVN~V~PG~v~T~~~~~~  200 (251)
T d2c07a1         157 --------------------------------ANYSSSKAGVIGFTKSLAKELASR----NITVNAIAPGFISSDMTDKI  200 (251)
T ss_dssp             --------------------------------HHHHHHHHHHHHHHHHHHHHHGGG----TEEEEEEEECSBCC-----C
T ss_pred             --------------------------------HHHHHHHHHHHHHHHHHHHHhhhh----CeEEEEEccCCEeccccccc
Confidence                                            789999999999999999999998    99999999999999998765


Q ss_pred             CC---------------CCHHhHHHHHHHHHhhhccccccccccccccceee
Q psy8786         372 GN---------------VNIFDDSSTFNAFERVISHFLIGQQINTFIPAIYT  408 (484)
Q Consensus       372 ~~---------------~~peevA~~~~~L~s~~a~~itG~~i~~~~~g~~~  408 (484)
                      .+               .+|+|+|+++.||+|+.++|+||++|  .+||||+
T Consensus       201 ~~~~~~~~~~~~pl~R~~~pedvA~~v~fL~S~~s~~itG~~i--~vDGG~s  250 (251)
T d2c07a1         201 SEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVF--VIDGGLS  250 (251)
T ss_dssp             CHHHHHHHHTTCTTSSCBCHHHHHHHHHHHHSGGGTTCCSCEE--EESTTSC
T ss_pred             CHHHHHHHHhcCCCCCCcCHHHHHHHHHHHhCchhCCCcCcEE--EECCCcC
Confidence            32               68999999999999999999999999  7898874



>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure