Diaphorina citri psyllid: psy8798

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MAETEDDQWLYGDQAGQNTGDPNTTEPPQPDPKEQSSFSELPAFSDIAQNPDPQGKFTVEEFEQIGTINSTAPHEFNLDQLEDKPWRKPGADITDYFNYGFTEETWRAHHMSSI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcc
***************************************************************QIGTINSTAPHEFNLDQLEDKPWRKPGADITDYFNYGFTEETWRAHHMSSI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAETEDDQWLYGDQAGQNTGDPNTTEPPQPDPKEQSSFSELPAFSDIAQNPDPQGKFTVEEFEQIGTINSTAPHEFNLDQLEDKPWRKPGADITDYFNYGFTEETWRAHHMSSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pre-mRNA polyadenylation factor fip1 Pre-mRNA polyadenylation factor that directly interacts with poly(A) polymerase.confidentQ09801

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted