Diaphorina citri psyllid: psy8804


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWDPGSMFLPQSR
cHHHHHHHHHHHccccccccccHHHHHHHHHcEEEEEEEcccEEEEccccccEEEEEEEEEEEEEcccccccccccccccccccCEEEEcccccEEEEEccECcccCEEccccc
*ADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWDPGSMFLPQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWDPGSMFLPQSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005085 [MF]guanyl-nucleotide exchange factor activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:0005575 [CC]cellular_componentprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O7F, chain A
Confidence level:very confident
Coverage over the Query: 2-95
View the alignment between query and template
View the model in PyMOL