Psyllid ID: psy8804


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWDPGSMFLPQSR
cHHHHHHHHHHHccccccccccHHHHHHHHHcEEEEEEEcccEEEEccccccEEEEEEEEEEEEEcccccccccccccccccccEEEEEcccccEEEEEccEEcccEEEccccc
cHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHEEEEcccccEEEEcccccccEEEEEEEcEEEEEccEEccccccccccccccccEEEEcccccHHHHHHHHcccccEEEcccc
MADDLQIIYYGLHglealapyRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSvfidgsmflpqsrnfvfnvfspvfglilnpsvsmaakvstlwdpgsmflpqsr
MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVStlwdpgsmflpqsr
MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWDPGSMFLPQSR
****LQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWD**********
*ADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQ*R*****VFSPVFGLILNPSVSMAAKVSTLWDPGSMFLPQ**
MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWDPGSMFLPQSR
MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWDPGSMFLP***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVSTLWDPGSMFLPQSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q8TEU7 1601 Rap guanine nucleotide ex no N/A 0.736 0.052 0.412 2e-12
Q8WZA2 1011 Rap guanine nucleotide ex no N/A 0.526 0.059 0.459 2e-06
Q9EQZ6 1011 Rap guanine nucleotide ex no N/A 0.526 0.059 0.459 3e-06
Q8VCC8 918 Rap guanine nucleotide ex no N/A 0.526 0.065 0.393 0.0003
O95398 923 Rap guanine nucleotide ex no N/A 0.526 0.065 0.393 0.0003
Q9Z1C8 926 Rap guanine nucleotide ex no N/A 0.526 0.064 0.393 0.0004
>sp|Q8TEU7|RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens GN=RAPGEF6 PE=1 SV=2 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 52/97 (53%), Gaps = 13/97 (13%)

Query: 3   DDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSV 62
           +DL  IY  LHG+E L+  R+  LR +    RYER+  N VL+ +  ++  WYILLSGSV
Sbjct: 23  EDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSGNQVLFCSETIARCWYILLSGSV 82

Query: 63  FIDGSMFLPQSRNFVFNVFSPVFG-------LILNPS 92
            + GSM LP         F   FG       L+L PS
Sbjct: 83  LVKGSMVLPPCS------FGKQFGGKRGCDCLVLEPS 113




Guanine nucleotide exchange factor (GEF) for Rap1A, Rap2A and M-Ras GTPases. Does not interact with cAMP.
Homo sapiens (taxid: 9606)
>sp|Q8WZA2|RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens GN=RAPGEF4 PE=1 SV=1 Back     alignment and function description
>sp|Q9EQZ6|RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus GN=Rapgef4 PE=1 SV=1 Back     alignment and function description
>sp|Q8VCC8|RPGF3_MOUSE Rap guanine nucleotide exchange factor 3 OS=Mus musculus GN=Rapgef3 PE=2 SV=2 Back     alignment and function description
>sp|O95398|RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens GN=RAPGEF3 PE=1 SV=6 Back     alignment and function description
>sp|Q9Z1C8|RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus GN=Rapgef3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
340713362 1390 PREDICTED: rap guanine nucleotide exchan 0.614 0.050 0.842 6e-29
350415848 1472 PREDICTED: rap guanine nucleotide exchan 0.614 0.047 0.842 8e-29
38386253794 PREDICTED: rap guanine nucleotide exchan 0.622 0.755 0.859 4e-28
270011783144 hypothetical protein TcasGA2_TC005859 [T 0.622 0.493 0.830 9e-28
32878246594 PREDICTED: rap guanine nucleotide exchan 0.622 0.755 0.845 1e-27
380021608143 PREDICTED: rap guanine nucleotide exchan 0.614 0.489 0.842 2e-27
345489066 1397 PREDICTED: rap guanine nucleotide exchan 0.815 0.066 0.666 2e-27
32872471092 PREDICTED: rap guanine nucleotide exchan 0.622 0.771 0.732 2e-24
241810635184 hypothetical protein IscW_ISCW023327 [Ix 0.666 0.413 0.618 5e-21
44371879890 hypothetical protein CAPTEDRAFT_116372 [ 0.622 0.788 0.661 3e-20
>gi|340713362|ref|XP_003395213.1| PREDICTED: rap guanine nucleotide exchange factor 6-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 59/70 (84%), Positives = 64/70 (91%)

Query: 4  DLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVF 63
          DLQIIYYGL GLEAL P RDS+LR LC++VRYERH AN VLYYTGEL+TSWYILLSGSVF
Sbjct: 24 DLQIIYYGLLGLEALRPCRDSILRGLCKIVRYERHHANHVLYYTGELATSWYILLSGSVF 83

Query: 64 IDGSMFLPQS 73
          IDGSMFLP+S
Sbjct: 84 IDGSMFLPRS 93




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350415848|ref|XP_003490767.1| PREDICTED: rap guanine nucleotide exchange factor 6-like, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|383862537|ref|XP_003706740.1| PREDICTED: rap guanine nucleotide exchange factor 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|270011783|gb|EFA08231.1| hypothetical protein TcasGA2_TC005859 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328782465|ref|XP_003250149.1| PREDICTED: rap guanine nucleotide exchange factor 6-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380021608|ref|XP_003694653.1| PREDICTED: rap guanine nucleotide exchange factor 6-like [Apis florea] Back     alignment and taxonomy information
>gi|345489066|ref|XP_003426046.1| PREDICTED: rap guanine nucleotide exchange factor 6-like isoform 4 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328724710|ref|XP_003248229.1| PREDICTED: rap guanine nucleotide exchange factor 6-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|241810635|ref|XP_002414562.1| hypothetical protein IscW_ISCW023327 [Ixodes scapularis] gi|215508773|gb|EEC18227.1| hypothetical protein IscW_ISCW023327 [Ixodes scapularis] Back     alignment and taxonomy information
>gi|443718798|gb|ELU09259.1| hypothetical protein CAPTEDRAFT_116372 [Capitella teleta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
UNIPROTKB|H0Y905 279 RAPGEF2 "Rap guanine nucleotid 0.614 0.250 0.628 7.2e-20
ZFIN|ZDB-GENE-090313-280 1525 si:dkey-253i9.4 "si:dkey-253i9 0.614 0.045 0.628 2.3e-18
ZFIN|ZDB-GENE-030131-6959 1601 rapgef2 "Rap guanine nucleotid 0.614 0.043 0.628 2.8e-18
UNIPROTKB|F1RTX9 1625 RAPGEF2 "Uncharacterized prote 0.614 0.043 0.628 2.8e-18
UNIPROTKB|F1P033 1583 Gga.30131 "Uncharacterized pro 0.596 0.042 0.485 2.1e-11
UNIPROTKB|F1NVX5 1591 Gga.30131 "Uncharacterized pro 0.596 0.042 0.485 2.1e-11
UNIPROTKB|B7Z7Y1 1204 RAPGEF6 "cDNA FLJ53249, highly 0.605 0.057 0.478 2.3e-11
UNIPROTKB|Q8TEU7 1601 RAPGEF6 "Rap guanine nucleotid 0.605 0.043 0.478 4.4e-11
UNIPROTKB|E9PCH4 1651 FNIP1 "Folliculin-interacting 0.596 0.041 0.485 7.6e-11
WB|WBGene00004254 1470 pxf-1 [Caenorhabditis elegans 0.605 0.046 0.420 2.4e-10
UNIPROTKB|H0Y905 RAPGEF2 "Rap guanine nucleotide exchange factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 236 (88.1 bits), Expect = 7.2e-20, P = 7.2e-20
 Identities = 44/70 (62%), Positives = 55/70 (78%)

Query:     4 DLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVF 63
             DL+I+Y  LHG+EAL+  R+  LR +C  VRYERH+AN+VLYY  ++ T WYILLSGSVF
Sbjct:    19 DLEIVYSYLHGMEALSNLREHQLRLMCETVRYERHEANEVLYYPDDIGTCWYILLSGSVF 78

Query:    64 IDGSMFLPQS 73
             I  SMFLP+S
Sbjct:    79 IKESMFLPRS 88




GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
ZFIN|ZDB-GENE-090313-280 si:dkey-253i9.4 "si:dkey-253i9.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6959 rapgef2 "Rap guanine nucleotide exchange factor (GEF) 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTX9 RAPGEF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P033 Gga.30131 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVX5 Gga.30131 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z7Y1 RAPGEF6 "cDNA FLJ53249, highly similar to Rap guanine nucleotide exchange factor 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TEU7 RAPGEF6 "Rap guanine nucleotide exchange factor 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PCH4 FNIP1 "Folliculin-interacting protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00004254 pxf-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 2e-06
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 2e-04
COG0664 214 COG0664, Crp, cAMP-binding proteins - catabolite g 0.001
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
 Score = 43.1 bits (102), Expect = 2e-06
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 4/68 (5%)

Query: 23 DSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNVFS 82
          D  L  L   +   R  A +V+   G+ + S YI+LSGSV +         R  +     
Sbjct: 7  DEELEELADALEERRFPAGEVIIRQGDPADSLYIVLSGSVEV--YKLDEDGREQIVGFLG 64

Query: 83 P--VFGLI 88
          P  +FG +
Sbjct: 65 PGDLFGEL 72


In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115

>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG3542|consensus 1283 99.47
PRK09392 236 ftrB transcriptional activator FtrB; Provisional 99.43
PLN02868 413 acyl-CoA thioesterase family protein 99.33
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.21
KOG1113|consensus 368 99.19
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.14
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.11
KOG0614|consensus 732 99.11
PRK11161 235 fumarate/nitrate reduction transcriptional regulat 99.1
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.1
cd00038115 CAP_ED effector domain of the CAP family of transc 99.09
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 98.87
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 98.75
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 98.67
KOG0498|consensus 727 98.63
KOG0614|consensus 732 98.6
PRK09391230 fixK transcriptional regulator FixK; Provisional 98.53
COG2905 610 Predicted signal-transduction protein containing c 98.5
KOG0500|consensus 536 98.44
KOG3542|consensus 1283 98.41
TIGR03697 193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 98.31
KOG1113|consensus368 98.21
KOG0499|consensus 815 97.94
KOG2968|consensus 1158 96.05
KOG0501|consensus 971 95.99
PF04831153 Popeye: Popeye protein conserved region; InterPro: 92.78
KOG2968|consensus 1158 92.76
>KOG3542|consensus Back     alignment and domain information
Probab=99.47  E-value=3.7e-14  Score=122.74  Aligned_cols=95  Identities=34%  Similarity=0.606  Sum_probs=87.3

Q ss_pred             ChhhHHHHHHHhhCCCCCCCCCHHHHHHHHhhcceeEecCCCEEEecCCCCCeEEEEEeeeEEEeCcccCCCCcceeecc
Q psy8804           1 MADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFIDGSMFLPQSRNFVFNV   80 (114)
Q Consensus         1 ~~ed~e~i~~~Lr~v~lF~~L~~~~l~~La~~~~~~~~~~G~~If~qGd~~~~~yiIlsG~VkI~g~~~~p~~~fg~~~~   80 (114)
                      +++|+...++.|+++..|++|-...|+.+|+.+++++++...++|+.||.+.+|||+++|+|.|.|.+++|.++||..+-
T Consensus        28 t~~~~rN~~~~lh~ld~~snl~~~~lk~l~~~aryer~~g~~ilf~~~~var~wyillsgsv~v~gqi~mp~~~fgkr~g  107 (1283)
T KOG3542|consen   28 TPDDIRNVYEQLHQLDTFSNLFIGPLKALCKTARYERHPGQYILFRDGDVARSWYILLSGSVFVEGQIYMPYGCFGKRTG  107 (1283)
T ss_pred             ChhhhhhHHHHHhhhhhhhhhhhhhHHHhhhhhhhhcCCCceEEecccchhhheeeeeccceEeecceecCccccccccc
Confidence            36788889999999999999999999999999999999999999999999999999999999999999999999995432


Q ss_pred             c-CceeeeeecCcccc
Q psy8804          81 F-SPVFGLILNPSVSM   95 (114)
Q Consensus        81 ~-~~~~~~~~~~~~~~   95 (114)
                      - ..|.||+|.++|.+
T Consensus       108 ~~r~~nclllq~semi  123 (1283)
T KOG3542|consen  108 QNRTHNCLLLQESEMI  123 (1283)
T ss_pred             cccccceeeeccccee
Confidence            2 38999999999954



>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1o7f_A469 Crystal Structure Of The Regulatory Domain Of Epac2 2e-07
4f7z_A 999 Conformational Dynamics Of Exchange Protein Directl 2e-07
3cf6_E 694 Structure Of Epac2 In Complex With Cyclic-Amp And R 2e-07
2byv_E 999 Structure Of The Camp Responsive Exchange Factor Ep 2e-07
>pdb|1O7F|A Chain A, Crystal Structure Of The Regulatory Domain Of Epac2 Length = 469 Back     alignment and structure

Iteration: 1

Score = 50.4 bits (119), Expect = 2e-07, Method: Composition-based stats. Identities = 28/61 (45%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Query: 3 DDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERH-QANDVLYYTGELSTSWYILLSGS 61 DDL+IIY L ++AL+ +V R L V+ +E H + VL+ GE TSWYI+L GS Sbjct: 330 DDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGS 389 Query: 62 V 62 V Sbjct: 390 V 390
>pdb|4F7Z|A Chain A, Conformational Dynamics Of Exchange Protein Directly Activated By Camp Length = 999 Back     alignment and structure
>pdb|3CF6|E Chain E, Structure Of Epac2 In Complex With Cyclic-Amp And Rap Length = 694 Back     alignment and structure
>pdb|2BYV|E Chain E, Structure Of The Camp Responsive Exchange Factor Epac2 In Its Auto-Inhibited State Length = 999 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 7e-23
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 5e-10
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 5e-12
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 3e-05
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 1e-10
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 1e-09
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 6e-05
3kcc_A 260 Catabolite gene activator; helix-turn-helix, CAMP, 1e-04
3ryp_A 210 Catabolite gene activator; CAMP receptor protein ( 2e-04
2oz6_A 207 Virulence factor regulator; winged helix, helix-tu 2e-04
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 2e-04
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 2e-04
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 5e-04
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 6e-04
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 8e-04
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
 Score = 91.1 bits (225), Expect = 7e-23
 Identities = 20/74 (27%), Positives = 39/74 (52%)

Query: 2   ADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGS 61
           ++D+ II+  L G++A   +  ++LR +C    YE  +    L+  G++ T+WY +L+GS
Sbjct: 34  SEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGS 93

Query: 62  VFIDGSMFLPQSRN 75
           + +  S        
Sbjct: 94  LDVKVSETSSHQDA 107


>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Length = 694 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.66
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.66
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.64
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.64
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.63
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.62
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 99.61
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.59
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.59
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.58
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.57
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.56
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.56
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.54
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.52
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.52
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.51
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.51
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.51
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 99.51
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.49
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 99.49
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.49
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.49
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.48
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.48
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.48
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.47
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.47
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.46
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.46
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.43
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.41
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 99.37
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.36
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.36
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.36
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 99.36
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.35
1ft9_A 222 Carbon monoxide oxidation system transcription reg 99.32
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.28
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.23
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.22
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.2
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.17
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.1
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.1
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.07
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 99.02
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 98.93
3b02_A 195 Transcriptional regulator, CRP family; structural 98.81
2zcw_A 202 TTHA1359, transcriptional regulator, FNR/CRP famil 98.71
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
Probab=99.66  E-value=3.4e-16  Score=105.95  Aligned_cols=94  Identities=10%  Similarity=0.069  Sum_probs=81.8

Q ss_pred             hhhHHHHHHHhhCCCCCCCCCHHHHHHHHhhcceeEecCCCEEEecCCCCCeEEEEEeeeEEEe--Cc---ccCCCCcce
Q psy8804           2 ADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERHQANDVLYYTGELSTSWYILLSGSVFID--GS---MFLPQSRNF   76 (114)
Q Consensus         2 ~ed~e~i~~~Lr~v~lF~~L~~~~l~~La~~~~~~~~~~G~~If~qGd~~~~~yiIlsG~VkI~--g~---~~~p~~~fg   76 (114)
                      +++.+.+.++|+++++|++|++++++.|+..+..+.|++|++|+++||+++++|+|++|.|++.  |+   ...||+.||
T Consensus        15 ~~~~~~~~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~~~g~~i~~~g~~~~~~y~i~~G~v~~~~~g~~~~~~~~G~~fG   94 (139)
T 3ocp_A           15 PQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFG   94 (139)
T ss_dssp             HHHHHHHHHHHHHCTTTTTSCHHHHHHHHHHCEEEEECSSCEEECTTSCCCEEEEEEECCEEEEETTEEEEEECTTCEES
T ss_pred             HHHHHHHHHHHhcCHhhhcCCHHHHHHHHHhcEEEecCCCCEEEeCCCcCCEEEEEEeCEEEEEECCEEEEEeCCCCEec
Confidence            4567778899999999999999999999999999999999999999999999999999999985  42   455999999


Q ss_pred             eecccC----ceeeeeecCcccc
Q psy8804          77 VFNVFS----PVFGLILNPSVSM   95 (114)
Q Consensus        77 ~~~~~~----~~~~~~~~~~~~~   95 (114)
                      +.+.+.    ++.+.++++++++
T Consensus        95 e~~~l~~~~~~~~~~a~~~~~v~  117 (139)
T 3ocp_A           95 ELAILYNCTRTATVKTLVNVKLW  117 (139)
T ss_dssp             CHHHHHCCCCSSEEEESSCEEEE
T ss_pred             cHHHHCCCCcceEEEECcceEEE
Confidence            887765    4566777777654



>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 5e-08
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 5e-06
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 0.002
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory domain of Epac2, domains 1 and 3
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 45.5 bits (107), Expect = 5e-08
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 2   ADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERH-QANDVLYYTGELSTSWYILLSG 60
            DDL+IIY  L  ++AL+    +V R L  V+ +E H +   VL+  GE  TSWYI+L G
Sbjct: 2   VDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKG 61

Query: 61  SVFIDGSMFLPQSRNFVFNVFSPVFGLILNPSVSMAAKVST 101
           SV +              + F  +  +   P  +       
Sbjct: 62  SVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLRED 102


>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.71
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.7
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.7
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.69
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.69
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.67
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.63
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.6
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.58
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.47
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.38
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.3
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.28
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.26
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.2
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.13
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.01
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory domain of Epac2, domains 1 and 3
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.71  E-value=3.1e-17  Score=109.82  Aligned_cols=94  Identities=30%  Similarity=0.416  Sum_probs=79.8

Q ss_pred             hhhHHHHHHHhhCCCCCCCCCHHHHHHHHhhcceeEe-cCCCEEEecCCCCCeEEEEEeeeEEEeC------cccCCCCc
Q psy8804           2 ADDLQIIYYGLHGLEALAPYRDSVLRSLCRVVRYERH-QANDVLYYTGELSTSWYILLSGSVFIDG------SMFLPQSR   74 (114)
Q Consensus         2 ~ed~e~i~~~Lr~v~lF~~L~~~~l~~La~~~~~~~~-~~G~~If~qGd~~~~~yiIlsG~VkI~g------~~~~p~~~   74 (114)
                      .+|++.+.+.|+++|+|++|+++.+++||..+..+.+ ++|++|+++||+++++|+|++|.|++..      ....||..
T Consensus         2 ~~d~~~i~~~L~~~~~F~~l~~~~l~~l~~~~~~~~~~~~ge~I~~~gd~~~~lyii~~G~v~~~~~~~~~~~~~~~G~~   81 (124)
T d1o7fa3           2 VDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD   81 (124)
T ss_dssp             HHHHHHHHHHHTTCGGGTTSCHHHHHHHHHHCEEEEECSTTCEEECTTSCCCEEEEEEESEEEEEETTTEEEEEEETTCE
T ss_pred             HHHHHHHHHHHhCCHhhhcCCHHHHHHHHhhCeEEEEcCCCCEEEECCCcCceEEEEEcceEEEEEeeeeecccccCCcc
Confidence            5899999999999999999999999999999988776 6799999999999999999999999742      24559999


Q ss_pred             ceeecccC----ceeeeeecC-cccc
Q psy8804          75 NFVFNVFS----PVFGLILNP-SVSM   95 (114)
Q Consensus        75 fg~~~~~~----~~~~~~~~~-~~~~   95 (114)
                      ||+.+++.    +..+.++++ .+++
T Consensus        82 fGe~~ll~~~~r~~t~~a~~~~~~l~  107 (124)
T d1o7fa3          82 FGKLALVNDAPRAASIVLREDNCHFL  107 (124)
T ss_dssp             ECGGGGTCCSCCSSEEEESSSSEEEE
T ss_pred             hhhhHhhCCCceeeEEEEEeCcEEEE
Confidence            99988886    445566665 3543



>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure