Diaphorina citri psyllid: psy8807

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MDTHTDTNHMQSCLTSVIHWELVYSTCYRRAALLADDMVITDFLFRNGKPFGRDLRAIDVQRGRDHGLASYNDYRAFCGLPRAYKFEDFLDVISPDLLLEDQLAEIKKASLARLLCDNSDEIHTMQPAAFLKISKE
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccccc
*****DTNHMQSCLTSVIHWELVYSTCYRRAALLADDMVITDFLFRNGKPFGRDLRAIDVQRGRDHGLASYNDYRAFCGLPRAYKFEDFLDVISPDLLLEDQLAEIKKASLARLLCDNSDEIHTMQPAAFLKI***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTHTDTNHMQSCLTSVIHWELVYSTCYRRAALLADDMVITDFLFRNGKPFGRDLRAIDVQRGRDHGLASYNDYRAFCGLPRAYKFEDFLDVISPDLLLEDQLAEIKKASLARLLCDNSDEIHTMQPAAFLKISKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxidase Involved in the chorion hardening process, through protein cross-linking mediated by the formation of di- and tri-tyrosine bonds.confidentQ01603

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042600 [CC]chorionprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0044699 [BP]single-organism processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D2V, chain C
Confidence level:very confident
Coverage over the Query: 18-134
View the alignment between query and template
View the model in PyMOL