Diaphorina citri psyllid: psy8820


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
ccccccEEEEEEEcEEEEEEEcccccEEEEEECccccEEEHHHHHHccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEccccEEEEEcccccccEEEEEEEcEEEEEEEcccccccEEEEEEccccEEEEEEccccccEEEEEEEEccEEEEEEcHHHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHHccccEEEEccccccc
QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0016044 [BP]cellular membrane organizationprobableGO:0009987, GO:0016043, GO:0061024, GO:0008150, GO:0071840, GO:0044763, GO:0044699
GO:0006643 [BP]membrane lipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255
GO:0046470 [BP]phosphatidylcholine metabolic processprobableGO:0006650, GO:0034641, GO:0006807, GO:0044281, GO:0044255, GO:0044710, GO:0071704, GO:0006644, GO:0006629, GO:0009308, GO:0009987, GO:0044106, GO:0042439, GO:0008152, GO:0046486, GO:0044238, GO:1901564, GO:0006576, GO:0044237, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:1901615
GO:0004622 [MF]lysophospholipase activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0004620, GO:0016298

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TNP, chain B
Confidence level:very confident
Coverage over the Query: 1-203
View the alignment between query and template
View the model in PyMOL