Psyllid ID: psy8820
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 234 | ||||||
| 357603741 | 785 | hypothetical protein KGM_05988 [Danaus p | 0.666 | 0.198 | 0.430 | 3e-32 | |
| 340711463 | 1332 | PREDICTED: neuropathy target esterase sw | 0.666 | 0.117 | 0.438 | 4e-32 | |
| 350416248 | 1268 | PREDICTED: neuropathy target esterase sw | 0.666 | 0.123 | 0.438 | 4e-32 | |
| 350416245 | 1332 | PREDICTED: neuropathy target esterase sw | 0.666 | 0.117 | 0.438 | 4e-32 | |
| 340711465 | 1363 | PREDICTED: neuropathy target esterase sw | 0.666 | 0.114 | 0.438 | 4e-32 | |
| 307205371 | 1240 | Protein Swiss cheese [Harpegnathos salta | 0.666 | 0.125 | 0.422 | 1e-31 | |
| 307188193 | 1271 | Protein Swiss cheese [Camponotus florida | 0.619 | 0.114 | 0.446 | 2e-31 | |
| 270002084 | 1312 | hypothetical protein TcasGA2_TC001035 [T | 0.863 | 0.153 | 0.361 | 3e-31 | |
| 383848584 | 1376 | PREDICTED: neuropathy target esterase sw | 0.658 | 0.111 | 0.425 | 4e-31 | |
| 328777223 | 1340 | PREDICTED: neuropathy target esterase sw | 0.666 | 0.116 | 0.432 | 4e-31 |
| >gi|357603741|gb|EHJ63906.1| hypothetical protein KGM_05988 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 144 bits (363), Expect = 3e-32, Method: Compositional matrix adjust.
Identities = 68/158 (43%), Positives = 113/158 (71%), Gaps = 2/158 (1%)
Query: 79 EQELIHSSKREFMEQLGVKDFSGL--DIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFI 136
EQ LI + F+++LG+ + L +++V +P GT +++EE +D L+Y+++G+L +
Sbjct: 224 EQALIKIASEAFVKELGLDNDQILKGNVQVRDLPAGTYIMKEESHKDVALVYLLSGALLV 283
Query: 137 TQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDAD 196
+Q+ ++G +VH+FTA+PG++ GGLAVLTGE S F+I+++ + I L + +++
Sbjct: 284 SQRVAEGEGEVHMFTAYPGEVEGGLAVLTGEPSFFSIRAKHFSRIGLLSKTTVYSIMRER 343
Query: 197 MNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY 234
+V L IA++V++R+SPFVRQ DFALDWVFLE G+AVY
Sbjct: 344 PSVVLHIANTVVRRLSPFVRQVDFALDWVFLESGRAVY 381
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340711463|ref|XP_003394295.1| PREDICTED: neuropathy target esterase sws-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350416248|ref|XP_003490887.1| PREDICTED: neuropathy target esterase sws-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|350416245|ref|XP_003490886.1| PREDICTED: neuropathy target esterase sws-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340711465|ref|XP_003394296.1| PREDICTED: neuropathy target esterase sws-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307205371|gb|EFN83712.1| Protein Swiss cheese [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307188193|gb|EFN73025.1| Protein Swiss cheese [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|270002084|gb|EEZ98531.1| hypothetical protein TcasGA2_TC001035 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383848584|ref|XP_003699929.1| PREDICTED: neuropathy target esterase sws-like, partial [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328777223|ref|XP_001120383.2| PREDICTED: neuropathy target esterase sws [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 234 | ||||||
| UNIPROTKB|H9KZH9 | 1070 | PNPLA6 "Uncharacterized protei | 0.649 | 0.142 | 0.393 | 1.9e-26 | |
| UNIPROTKB|E2RIR2 | 1366 | PNPLA6 "Uncharacterized protei | 0.726 | 0.124 | 0.373 | 2.9e-26 | |
| UNIPROTKB|Q8IY17 | 1366 | PNPLA6 "Neuropathy target este | 0.709 | 0.121 | 0.370 | 1.6e-25 | |
| UNIPROTKB|G3X6Z1 | 1302 | LOC536255 "Uncharacterized pro | 0.807 | 0.145 | 0.338 | 2.5e-25 | |
| UNIPROTKB|F1SCJ2 | 1365 | PNPLA6 "Uncharacterized protei | 0.709 | 0.121 | 0.358 | 6.9e-25 | |
| UNIPROTKB|Q5T362 | 1281 | PNPLA7 "Patatin-like phospholi | 0.807 | 0.147 | 0.343 | 8.4e-25 | |
| UNIPROTKB|Q6ZV29 | 1317 | PNPLA7 "Patatin-like phospholi | 0.807 | 0.143 | 0.343 | 8.7e-25 | |
| UNIPROTKB|E1BMJ5 | 1320 | PNPLA6 "Uncharacterized protei | 0.709 | 0.125 | 0.352 | 3.5e-24 | |
| UNIPROTKB|E2QXW6 | 1456 | PNPLA7 "Uncharacterized protei | 0.807 | 0.129 | 0.333 | 2.4e-23 | |
| RGD|1564611 | 1326 | Pnpla6 "patatin-like phospholi | 0.858 | 0.151 | 0.324 | 5.7e-23 |
| UNIPROTKB|H9KZH9 PNPLA6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 280 (103.6 bits), Expect = 1.9e-26, Sum P(2) = 1.9e-26
Identities = 61/155 (39%), Positives = 96/155 (61%)
Query: 82 LIHSSKREFMEQLGVKDFSGLDIRV--EHIPGGTCLVREEVVEDNKLIYVIAGSLFITQK 139
+ ++K+E ++ + V+D S L+ RV H GT + R+ +D L +V+ G L + Q+
Sbjct: 337 IFEAAKQELVKLMKVEDPSLLNNRVLLHHAKAGTVIARQGD-QDVSLHFVLWGCLHVYQR 395
Query: 140 SSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNV 199
D + DV LF PG+M+G LAVLTGE +FTI++ T + + D ++ +V
Sbjct: 396 MIDKAEDVCLFLTQPGEMVGQLAVLTGEPLIFTIKANRDCTFLKISKSDFYEIMREQPSV 455
Query: 200 TLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY 234
L +AH+V+ RMSPFVRQ DFA+DW+ +E G+A+Y
Sbjct: 456 VLSVAHTVVTRMSPFVRQMDFAIDWMAVEAGRALY 490
|
|
| UNIPROTKB|E2RIR2 PNPLA6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IY17 PNPLA6 "Neuropathy target esterase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X6Z1 LOC536255 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SCJ2 PNPLA6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5T362 PNPLA7 "Patatin-like phospholipase domain-containing protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZV29 PNPLA7 "Patatin-like phospholipase domain-containing protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BMJ5 PNPLA6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QXW6 PNPLA7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1564611 Pnpla6 "patatin-like phospholipase domain containing 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 234 | |||
| cd00038 | 115 | cd00038, CAP_ED, effector domain of the CAP family | 1e-12 | |
| pfam00027 | 91 | pfam00027, cNMP_binding, Cyclic nucleotide-binding | 4e-11 | |
| smart00100 | 120 | smart00100, cNMP, Cyclic nucleotide-monophosphate | 2e-08 | |
| COG0664 | 214 | COG0664, Crp, cAMP-binding proteins - catabolite g | 7e-08 | |
| cd00038 | 115 | cd00038, CAP_ED, effector domain of the CAP family | 2e-06 | |
| pfam00027 | 91 | pfam00027, cNMP_binding, Cyclic nucleotide-binding | 2e-06 | |
| COG0664 | 214 | COG0664, Crp, cAMP-binding proteins - catabolite g | 5e-05 |
| >gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
Score = 62.3 bits (152), Expect = 1e-12
Identities = 25/64 (39%), Positives = 36/64 (56%)
Query: 3 DRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSEL 62
D +DS YIVL+G + K E G+ + GDL G + ++ + R+ TV A+ DSEL
Sbjct: 33 DPADSLYIVLSGSVEVYKLDEDGREQIVGFLGPGDLFGELALLGNGPRSATVRALTDSEL 92
Query: 63 AKLP 66
LP
Sbjct: 93 LVLP 96
|
In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115 |
| >gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| KOG1113|consensus | 368 | 99.95 | ||
| KOG0614|consensus | 732 | 99.94 | ||
| KOG2968|consensus | 1158 | 99.9 | ||
| KOG2968|consensus | 1158 | 99.81 | ||
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 99.73 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 99.73 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 99.72 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 99.69 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 99.68 | |
| COG0664 | 214 | Crp cAMP-binding proteins - catabolite gene activa | 99.68 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 99.66 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 99.63 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 99.6 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 99.58 | |
| cd00038 | 115 | CAP_ED effector domain of the CAP family of transc | 99.58 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 99.54 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 99.53 | |
| COG0664 | 214 | Crp cAMP-binding proteins - catabolite gene activa | 99.52 | |
| smart00100 | 120 | cNMP Cyclic nucleotide-monophosphate binding domai | 99.51 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.5 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 99.5 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 99.41 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.4 | |
| KOG1113|consensus | 368 | 99.39 | ||
| cd00038 | 115 | CAP_ED effector domain of the CAP family of transc | 99.37 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 99.37 | |
| KOG0498|consensus | 727 | 99.36 | ||
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 99.36 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 99.32 | |
| KOG0614|consensus | 732 | 99.26 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.25 | |
| smart00100 | 120 | cNMP Cyclic nucleotide-monophosphate binding domai | 99.23 | |
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 99.22 | |
| KOG0500|consensus | 536 | 99.09 | ||
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 99.04 | |
| KOG0499|consensus | 815 | 99.02 | ||
| KOG0498|consensus | 727 | 98.87 | ||
| KOG0499|consensus | 815 | 98.82 | ||
| KOG0500|consensus | 536 | 98.77 | ||
| COG2905 | 610 | Predicted signal-transduction protein containing c | 98.6 | |
| KOG0501|consensus | 971 | 98.21 | ||
| PRK11832 | 207 | putative DNA-binding transcriptional regulator; Pr | 98.07 | |
| PF04831 | 153 | Popeye: Popeye protein conserved region; InterPro: | 97.9 | |
| PRK11832 | 207 | putative DNA-binding transcriptional regulator; Pr | 97.21 | |
| KOG0501|consensus | 971 | 97.18 | ||
| PF04831 | 153 | Popeye: Popeye protein conserved region; InterPro: | 96.53 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 94.14 | |
| KOG3542|consensus | 1283 | 93.52 | ||
| PF04648 | 13 | MF_alpha: Yeast mating factor alpha hormone; Inter | 93.51 | |
| KOG3542|consensus | 1283 | 93.23 | ||
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 91.92 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 91.63 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 90.41 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 89.64 | |
| KOG2378|consensus | 573 | 87.84 | ||
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 87.1 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 86.32 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 84.48 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 83.54 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 82.71 |
| >KOG1113|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=2e-27 Score=190.80 Aligned_cols=187 Identities=18% Similarity=0.208 Sum_probs=153.2
Q ss_pred CCCCCCEEEEEEcceEEEEEEcCCCcEEEEEeecCCcEeeeeccccCCCceeEEEEccceeEEEeCccccccccCCCchH
Q psy8820 1 QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQ 80 (234)
Q Consensus 1 ~Gd~~~~~yii~~G~v~v~~~~~~g~~~~~~~~~~G~~fGe~~ll~~~~r~~tv~A~~~~~l~~i~~~~f~~l~~~~p~~ 80 (234)
|||.||.||+|.+|++.|++.. ..+..++||.+|||+||+.+.||.||++|.+++.+|.+++..|..++..+..
T Consensus 159 qGdeGd~fYvI~kGt~dVyv~~-----~~v~~~~~g~sFGElALmyn~PRaATv~a~t~~klWgldr~SFrrIi~~s~~- 232 (368)
T KOG1113|consen 159 QGDEGDNFYVIDKGTFDVYVNG-----TYVTTYSPGGSFGELALMYNPPRAATVVAKSLKKLWGLDRTSFRRIIMKSCI- 232 (368)
T ss_pred cCCcCCcEEEEecceEEEEECC-----eEEeeeCCCCchhhhHhhhCCCcccceeeccccceEEEeeceeEEEeeccch-
Confidence 7999999999999999999873 6789999999999999999999999999999999999999999998776541
Q ss_pred HHHHHHHHHHHHHhCC------CCCcccccee--eeecCCCEEEEecCCCCceEEEEEeCeEEEEEecCCCCccEEEEEE
Q psy8820 81 ELIHSSKREFMEQLGV------KDFSGLDIRV--EHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTA 152 (234)
Q Consensus 81 ~l~~~~~~~l~~~l~~------~~~~~l~~~~--~~~~~g~~i~~~~g~~~~~~y~I~~G~v~v~~~~~~g~~~~~~~~~ 152 (234)
...+.. ..+.+..++ .++.-+.+.+ +.|++|+.|..+ |++++.+|+|.+|++.+.... +| ..+ .+
T Consensus 233 kkrkMy-~~~l~s~pil~~l~k~er~kv~dal~~k~y~~G~~Vi~q-g~~ge~f~~i~eGEvdv~~~~-~~---v~v-kl 305 (368)
T KOG1113|consen 233 KKRKMY-EPFLESVPILESLEKLERAKVADALGTKSYKDGERVIVQ-GDQGEHFYIIEEGEVDVLKKR-DG---VEV-KL 305 (368)
T ss_pred hhhhhh-hhhhhcchhhHHHHHHHHHhhhcccceeeccCCceEEec-cCCcceEEEecccccchhhcc-CC---eEE-Ee
Confidence 111111 111111111 0111222333 899999999999 999999999999999998765 22 444 89
Q ss_pred CCCceEEeeeeeeCcceEEEEEEcCCeEEEEeCHHhHHHHHhcchHHH
Q psy8820 153 FPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVT 200 (234)
Q Consensus 153 ~~g~~~G~~~~l~~~~~~~~v~A~~~~~~~~i~~~~~~~l~~~~p~~~ 200 (234)
+.||+||+.+++.+.|+.++|.|..+..|..++++.|+.++.-...++
T Consensus 306 ~~~dyfge~al~~~~pr~Atv~a~~~~kc~~~dk~~ferllgpc~dil 353 (368)
T KOG1113|consen 306 KKGDYFGELALLKNLPRAATVVAKGRLKCAKLDKPRFERLLGPCQDIL 353 (368)
T ss_pred chhhhcchHHHHhhchhhceeeccCCceeeeeChHHHHHHhhHHHHHH
Confidence 999999999999999999999999999999999999999998665544
|
|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >KOG2968|consensus | Back alignment and domain information |
|---|
| >KOG2968|consensus | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00100 cNMP Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1113|consensus | Back alignment and domain information |
|---|
| >cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >smart00100 cNMP Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >KOG0500|consensus | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >KOG0499|consensus | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >KOG0499|consensus | Back alignment and domain information |
|---|
| >KOG0500|consensus | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0501|consensus | Back alignment and domain information |
|---|
| >PRK11832 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle | Back alignment and domain information |
|---|
| >PRK11832 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0501|consensus | Back alignment and domain information |
|---|
| >PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3542|consensus | Back alignment and domain information |
|---|
| >PF04648 MF_alpha: Yeast mating factor alpha hormone; InterPro: IPR006742 This repeated sequence,WHWLQLKPGQPMY, characterises the mating factor alpha-1 or alpha-1 mating pheromone [contains: Mating factor alpha] | Back alignment and domain information |
|---|
| >KOG3542|consensus | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >KOG2378|consensus | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 234 | |||
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 3e-08 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 2e-06 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 2e-07 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 2e-04 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 3e-07 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 3e-07 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 2e-04 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 9e-07 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 1e-06 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 2e-05 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 2e-06 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 4e-04 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 3e-06 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 4e-05 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 3e-06 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 1e-04 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 5e-06 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 6e-06 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 7e-06 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 1e-05 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 1e-05 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 1e-05 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 1e-05 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 2e-04 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 1e-05 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 2e-05 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 2e-05 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 3e-05 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 4e-05 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 4e-05 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 4e-05 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 6e-05 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 7e-05 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 8e-05 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 2e-04 |
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 | Back alignment and structure |
|---|
Score = 50.9 bits (122), Expect = 3e-08
Identities = 17/77 (22%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
Query: 3 DRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSEL 62
D D ++LTG + +K + + + A+ G ++G + M+ R+ + +A ++
Sbjct: 78 DPGDYLLLILTGEVNVIKDIPNKGIQTIAKVGAGAIIGEMSMIDGMPRSASCVASLPTDF 137
Query: 63 AKLP-EGLCDHLPRSPS 78
A L + L L P
Sbjct: 138 AVLSRDALYQLLANMPK 154
|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 100.0 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 100.0 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 100.0 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 100.0 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 99.98 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 99.95 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 99.95 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 99.82 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 99.8 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 99.79 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 99.79 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 99.77 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 99.76 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 99.76 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 99.75 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 99.75 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 99.75 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 99.74 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 99.74 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 99.74 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 99.74 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 99.74 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 99.73 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 99.73 | |
| 3ukn_A | 212 | Novel protein similar to vertebrate potassium VOL | 99.73 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 99.72 | |
| 2ptm_A | 198 | Hyperpolarization-activated (IH) channel; ION chan | 99.72 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 99.71 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 99.71 | |
| 3idb_B | 161 | CAMP-dependent protein kinase type II-beta regulat | 99.71 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 99.7 | |
| 1vp6_A | 138 | CNBD, cyclic-nucleotide binding domain of mesorhiz | 99.7 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 99.69 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 99.68 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 99.68 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 99.68 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 99.68 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.67 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 99.67 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 99.67 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 99.66 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 99.65 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 99.65 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 99.65 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 99.63 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 99.63 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 99.62 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 99.62 | |
| 3idb_B | 161 | CAMP-dependent protein kinase type II-beta regulat | 99.61 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 99.61 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 99.61 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 99.59 | |
| 1wgp_A | 137 | Probable cyclic nucleotide-gated ION channel 6; cy | 99.59 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 99.59 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 99.59 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 99.58 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 99.58 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 99.58 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 99.58 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 99.57 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 99.56 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 99.56 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 99.56 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 99.55 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 99.55 | |
| 2ptm_A | 198 | Hyperpolarization-activated (IH) channel; ION chan | 99.55 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 99.54 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 99.53 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 99.52 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 99.52 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 99.51 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.51 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 99.5 | |
| 3ukn_A | 212 | Novel protein similar to vertebrate potassium VOL | 99.48 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 99.48 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 99.47 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 99.47 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 99.47 | |
| 1vp6_A | 138 | CNBD, cyclic-nucleotide binding domain of mesorhiz | 99.46 | |
| 1wgp_A | 137 | Probable cyclic nucleotide-gated ION channel 6; cy | 99.46 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 99.46 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.44 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 99.43 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 99.41 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 99.4 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 99.37 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 99.35 | |
| 3cf6_E | 694 | RAP guanine nucleotide exchange factor (GEF) 4; EP | 99.3 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.15 | |
| 3cf6_E | 694 | RAP guanine nucleotide exchange factor (GEF) 4; EP | 99.13 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 96.92 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 94.95 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 92.74 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 92.63 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 92.29 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 92.15 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 89.62 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 88.53 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 87.62 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 86.6 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 86.57 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 86.39 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 86.22 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 85.48 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 84.55 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 80.85 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 80.41 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 80.29 |
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-34 Score=237.61 Aligned_cols=208 Identities=15% Similarity=0.165 Sum_probs=173.3
Q ss_pred CCCCCCEEEEEEcceEEEEEEcCCCcEEEEEeecCCcEeeeeccccCCCceeEEEEccceeEEEeCccccccccCCCchH
Q psy8820 1 QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQ 80 (234)
Q Consensus 1 ~Gd~~~~~yii~~G~v~v~~~~~~g~~~~~~~~~~G~~fGe~~ll~~~~r~~tv~A~~~~~l~~i~~~~f~~l~~~~p~~ 80 (234)
|||+++.+|+|++|.|+++. +| ..+..+++|++|||.+++.+.||++|++|.++|+++.|+++.|..++...|.
T Consensus 76 ~G~~~~~~yiI~~G~v~v~~---~g--~~~~~~~~G~~fGe~~ll~~~~~~~tv~a~~~~~l~~i~~~~~~~i~~~~~~- 149 (299)
T 3shr_A 76 EGDVGSLVYVMEDGKVEVTK---EG--VKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGL- 149 (299)
T ss_dssp TTCBCCCEEEEEESCEEEEE---TT--EEEEEECTTCEESCSGGGTTTBCCSEEEESSCEEEEEECHHHHHHHHHHHHH-
T ss_pred CCCcCceEEEEEEEEEEEEE---CC--EEEEEeCCCCeeeHhHHhcCCCCCcEEEEcCCeEEEEEcHHHHHHHhhHhHH-
Confidence 79999999999999999965 34 6788999999999999999999999999999999999999999999888773
Q ss_pred HHHHHHHHHHHH---HhCCCCC--ccccc--eeeeecCCCEEEEecCCCCceEEEEEeCeEEEEEec-CCCCccEEEEEE
Q psy8820 81 ELIHSSKREFME---QLGVKDF--SGLDI--RVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKS-SDGSNDVHLFTA 152 (234)
Q Consensus 81 ~l~~~~~~~l~~---~l~~~~~--~~l~~--~~~~~~~g~~i~~~~g~~~~~~y~I~~G~v~v~~~~-~~g~~~~~~~~~ 152 (234)
.........+.. ...+.+. ..+.. ..+.|++|++|+++ |+.++.+|+|++|.++++... .+| ++..+..+
T Consensus 150 ~~~~~~~~~l~~~~~f~~l~~~~l~~l~~~~~~~~~~~g~~I~~~-G~~~~~~yiI~~G~v~~~~~~~~~g-~~~~~~~l 227 (299)
T 3shr_A 150 IKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQ-GARGDTFFIISKGKVNVTREDSPNE-DPVFLRTL 227 (299)
T ss_dssp HHHHHHHHHHTTSHHHHHSCHHHHHHHTTTCEEEEECTTCEEECT-TCEECEEEEEEESEEEEEECCSSSC-CCEEEEEE
T ss_pred HHHHHHHHHHhhCHHhhhCCHHHHHHHHHhccEEEECCCCEEEeC-CCCCCEEEEEEeeEEEEEEecCCCC-cceEEEEc
Confidence 111111011100 0011111 11222 33899999999999 999999999999999999876 344 78899999
Q ss_pred CCCceEEeeeeeeCcceEEEEEEcCCeEEEEeCHHhHHHHHhcchHHHHHHHHHHHHhhchhhh
Q psy8820 153 FPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVR 216 (234)
Q Consensus 153 ~~g~~~G~~~~l~~~~~~~~v~A~~~~~~~~i~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~ 216 (234)
++|++||+.+++.+.|+.++++|.++|+++.|++++|.+++.++|.+..++.+.+.+|+.....
T Consensus 228 ~~G~~fGe~~ll~~~~~~~tv~a~~~~~l~~i~~~~f~~ll~~~p~~~~~~~~~l~~r~~~~~~ 291 (299)
T 3shr_A 228 GKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE 291 (299)
T ss_dssp ETTCEECGGGGSSSEECSSEEEESSSEEEEEEEHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHH
T ss_pred CCCCEeChHHHhCCCCcceEEEECCCEEEEEEeHHHHHHHHccHHHHHHHHHHHHhhhhhcchh
Confidence 9999999999999999999999999999999999999999999999999999999888776643
|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 99.82 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 99.82 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 99.82 | |
| d1o5la1 | 129 | CRP-like transcriptional regulator TM1171, N-termi | 99.8 | |
| d2gaua2 | 142 | Transcriptional regulator PG0396, N-terminal domai | 99.8 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 99.8 | |
| d1zyba2 | 147 | Probable transcription regulator BT4300, N-termina | 99.8 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 99.78 | |
| d1ne6a2 | 132 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.76 | |
| d1cx4a2 | 147 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.75 | |
| d1vp6a_ | 133 | Putative ion channel CnbD {Mesorhizobium loti [Tax | 99.7 | |
| d1cx4a1 | 136 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.7 | |
| d1ne6a1 | 136 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.69 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 99.68 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 99.66 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 99.66 | |
| d1o7fa2 | 155 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.66 | |
| d1q3ea_ | 193 | HCN pacemaker channel {Mouse (Mus musculus) [TaxId | 99.66 | |
| d1cx4a2 | 147 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.63 | |
| d2gaua2 | 142 | Transcriptional regulator PG0396, N-terminal domai | 99.63 | |
| d1wgpa_ | 137 | Probable cyclic nucleotide-gated ion channel 6 {Th | 99.62 | |
| d1o5la1 | 129 | CRP-like transcriptional regulator TM1171, N-termi | 99.62 | |
| d1zyba2 | 147 | Probable transcription regulator BT4300, N-termina | 99.62 | |
| d1ne6a2 | 132 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.62 | |
| d1o7fa3 | 124 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.62 | |
| d1ne6a1 | 136 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.61 | |
| d1cx4a1 | 136 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.6 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 99.57 | |
| d1o7fa3 | 124 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.56 | |
| d1o7fa2 | 155 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.56 | |
| d1q3ea_ | 193 | HCN pacemaker channel {Mouse (Mus musculus) [TaxId | 99.48 | |
| d1vp6a_ | 133 | Putative ion channel CnbD {Mesorhizobium loti [Tax | 99.47 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 99.45 | |
| d1wgpa_ | 137 | Probable cyclic nucleotide-gated ion channel 6 {Th | 99.43 | |
| d2bgca2 | 131 | Listeriolysin regulatory protein PrfA, N-terminal | 97.51 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 94.46 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 94.37 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 91.43 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 91.18 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 90.13 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 89.05 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 88.98 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 88.7 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 88.39 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 88.24 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 85.7 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 85.2 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 84.18 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 83.02 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 82.87 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 82.75 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 82.34 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 82.2 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 80.99 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 80.51 |
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: cAMP-binding domain-like family: cAMP-binding domain domain: Catabolite gene activator protein, N-terminal domain species: Escherichia coli [TaxId: 562]
Probab=99.82 E-value=3.8e-20 Score=131.98 Aligned_cols=113 Identities=17% Similarity=0.374 Sum_probs=102.9
Q ss_pred eeeeecCCCEEEEecCCCCceEEEEEeCeEEEEEecCCCCccEEEEEECCCceEEeeeeee-CcceEEEEEEcCCeEEEE
Q psy8820 105 RVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLT-GEASVFTIQSRLPATIAW 183 (234)
Q Consensus 105 ~~~~~~~g~~i~~~~g~~~~~~y~I~~G~v~v~~~~~~g~~~~~~~~~~~g~~~G~~~~l~-~~~~~~~v~A~~~~~~~~ 183 (234)
.++.|++|++|+++ |++++.+|+|++|.++++..+.+| ++.++..+.+|++||+.+++. +.++.++++|.++|+++.
T Consensus 14 ~~~~~~~g~~i~~~-g~~~~~iy~i~~G~v~~~~~~~~g-~e~~l~~~~~G~~~G~~~~~~~~~~~~~~~~a~~~~~v~~ 91 (132)
T d1i5za2 14 HIHKYPSKSTLIHQ-GEKAETLYYIVKGSVAVLIKDEEG-KEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAE 91 (132)
T ss_dssp EEEEECTTCEEECT-TSBCCEEEEEEECCEEEEEECTTC-CEEEEEEECTTCEESCTTTTSSSCBCCSEEEESSCEEEEE
T ss_pred EEEEECcCCEEEcC-CCCCCEEEEEEEccceeeeccccc-hhhhhhhhCcccccchHHHhcCCccceEEEEEccceEEEE
Confidence 44799999999999 999999999999999999888777 789999999999999988886 577889999999999999
Q ss_pred eCHHhHHHHHhcchHHHHHHHHHHHHhhchhhhhcc
Q psy8820 184 LPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFD 219 (234)
Q Consensus 184 i~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~ 219 (234)
||++.|.++++++|.+..++++.+.+|+....+++.
T Consensus 92 i~~~~~~~~~~~~~~~~~~~~~~l~~rl~~~~~~i~ 127 (132)
T d1i5za2 92 ISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVG 127 (132)
T ss_dssp EEHHHHHHHHHHCTHHHHHHHHHHHHHHHHHHHHHH
T ss_pred EcHHHHHHHHhhCHHHHHHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999888877655544
|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|