Psyllid ID: psy8820


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
ccccccEEEEEEEcEEEEEEEcccccEEEEEEEccccEEEHHHHHHccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccEEEccccEEEEEcccccccEEEEEEEcEEEEEEEcccccccEEEEEEccccEEEEEEccccccEEEEEEEEccEEEEEEcHHHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHHccccEEEEccccccc
ccccccEEEEEEEccEEEEEEcccccEEEEEEcccccEEEEEEEEcccccccEEEEEcccHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHcccEEEEEcccEEEEEEcccccEEEEEEEEEEEEEEEEcccccccEEEEEEccccEEEEEHHHcccccEEEEEEEEcEEEEEEcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEcc
qydrsdstyIVLTGRLRSvktlesgkrkeeaeyskgdLVGLIEMVTSTSRNTTVMAVRDselaklpeglcdhlprspseqeLIHSSKREFMEqlgvkdfsgldirvehipggtclvreevveDNKLIYVIAGSLFitqkssdgsndvhlftafpgdmigglavLTGEASVFTIQSrlpatiawlpqddcstlidADMNVTLKIAHSVLKrmspfvrqfdFALDWVFLEGGQAVY
qydrsdstyivltgrlrsvktlesgkrkeeaeyskgdlvglIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
********YIVLTGRL********************DLVGLIEMVT*********************************************EQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEG*****
QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKS******VHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
QYDRSDSTYIVLTGRLRSVKT************SKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
****SDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query234 2.2.26 [Sep-21-2011]
Q6ZV29 1317 Patatin-like phospholipas yes N/A 0.807 0.143 0.343 2e-25
Q5RDS0 1365 Neuropathy target esteras yes N/A 0.649 0.111 0.393 2e-24
Q8IY17 1366 Neuropathy target esteras no N/A 0.649 0.111 0.387 3e-24
Q3TRM4 1355 Neuropathy target esteras yes N/A 0.739 0.127 0.345 5e-24
A2AJ88 1352 Patatin-like phospholipas no N/A 0.649 0.112 0.374 3e-23
Q5BK26 1349 Patatin-like phospholipas no N/A 0.649 0.112 0.361 1e-22
B4M709 1483 Neuropathy target esteras N/A N/A 0.722 0.113 0.324 1e-21
B4L535 1488 Neuropathy target esteras N/A N/A 0.666 0.104 0.331 8e-21
B4JLX2 1464 Neuropathy target esteras N/A N/A 0.243 0.038 0.690 4e-20
Q9U969 1425 Neuropathy target esteras yes N/A 0.277 0.045 0.690 6e-20
>sp|Q6ZV29|PLPL7_HUMAN Patatin-like phospholipase domain-containing protein 7 OS=Homo sapiens GN=PNPLA7 PE=2 SV=3 Back     alignment and function desciption
 Score =  116 bits (290), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 109/192 (56%), Gaps = 3/192 (1%)

Query: 45  VTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQELIHSSKREFMEQLGVKDFSGLDI 104
           V S SR + ++A   S +++  E   D    S     +  ++K++ +  + ++D S LD 
Sbjct: 414 VASKSRKSVMVAEIPSTVSQHSESHTDETLASRKSDAIFRAAKKDLLTLMKLEDSSLLDG 473

Query: 105 RVE--HIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLA 162
           RV   H+P GT + R+   +D  +++V++G L + Q+      D  LF   PG+M+G LA
Sbjct: 474 RVALLHVPAGTVVSRQGD-QDASILFVVSGLLHVYQRKIGSQEDTCLFLTRPGEMVGQLA 532

Query: 163 VLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFDFAL 222
           VLTGE  +FT+++    +   + +     ++     V L +AH+V+KRMS FVRQ DFAL
Sbjct: 533 VLTGEPLIFTVKANRDCSFLSISKAHFYEIMRKQPTVVLGVAHTVVKRMSSFVRQIDFAL 592

Query: 223 DWVFLEGGQAVY 234
           DWV +E G+A+Y
Sbjct: 593 DWVEVEAGRAIY 604




Serine hydrolase, whose specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q5RDS0|PLPL6_PONAB Neuropathy target esterase OS=Pongo abelii GN=PNPLA6 PE=2 SV=1 Back     alignment and function description
>sp|Q8IY17|PLPL6_HUMAN Neuropathy target esterase OS=Homo sapiens GN=PNPLA6 PE=1 SV=2 Back     alignment and function description
>sp|Q3TRM4|PLPL6_MOUSE Neuropathy target esterase OS=Mus musculus GN=Pnpla6 PE=2 SV=2 Back     alignment and function description
>sp|A2AJ88|PLPL7_MOUSE Patatin-like phospholipase domain-containing protein 7 OS=Mus musculus GN=Pnpla7 PE=1 SV=1 Back     alignment and function description
>sp|Q5BK26|PLPL7_RAT Patatin-like phospholipase domain-containing protein 7 OS=Rattus norvegicus GN=Pnpla7 PE=1 SV=2 Back     alignment and function description
>sp|B4M709|SWS_DROVI Neuropathy target esterase sws OS=Drosophila virilis GN=sws PE=3 SV=1 Back     alignment and function description
>sp|B4L535|SWS_DROMO Neuropathy target esterase sws OS=Drosophila mojavensis GN=sws PE=3 SV=1 Back     alignment and function description
>sp|B4JLX2|SWS_DROGR Neuropathy target esterase sws OS=Drosophila grimshawi GN=sws PE=3 SV=1 Back     alignment and function description
>sp|Q9U969|SWS_DROME Neuropathy target esterase sws OS=Drosophila melanogaster GN=sws PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
357603741 785 hypothetical protein KGM_05988 [Danaus p 0.666 0.198 0.430 3e-32
340711463 1332 PREDICTED: neuropathy target esterase sw 0.666 0.117 0.438 4e-32
350416248 1268 PREDICTED: neuropathy target esterase sw 0.666 0.123 0.438 4e-32
350416245 1332 PREDICTED: neuropathy target esterase sw 0.666 0.117 0.438 4e-32
340711465 1363 PREDICTED: neuropathy target esterase sw 0.666 0.114 0.438 4e-32
307205371 1240 Protein Swiss cheese [Harpegnathos salta 0.666 0.125 0.422 1e-31
307188193 1271 Protein Swiss cheese [Camponotus florida 0.619 0.114 0.446 2e-31
270002084 1312 hypothetical protein TcasGA2_TC001035 [T 0.863 0.153 0.361 3e-31
383848584 1376 PREDICTED: neuropathy target esterase sw 0.658 0.111 0.425 4e-31
328777223 1340 PREDICTED: neuropathy target esterase sw 0.666 0.116 0.432 4e-31
>gi|357603741|gb|EHJ63906.1| hypothetical protein KGM_05988 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  144 bits (363), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 113/158 (71%), Gaps = 2/158 (1%)

Query: 79  EQELIHSSKREFMEQLGVKDFSGL--DIRVEHIPGGTCLVREEVVEDNKLIYVIAGSLFI 136
           EQ LI  +   F+++LG+ +   L  +++V  +P GT +++EE  +D  L+Y+++G+L +
Sbjct: 224 EQALIKIASEAFVKELGLDNDQILKGNVQVRDLPAGTYIMKEESHKDVALVYLLSGALLV 283

Query: 137 TQKSSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDAD 196
           +Q+ ++G  +VH+FTA+PG++ GGLAVLTGE S F+I+++  + I  L +    +++   
Sbjct: 284 SQRVAEGEGEVHMFTAYPGEVEGGLAVLTGEPSFFSIRAKHFSRIGLLSKTTVYSIMRER 343

Query: 197 MNVTLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY 234
            +V L IA++V++R+SPFVRQ DFALDWVFLE G+AVY
Sbjct: 344 PSVVLHIANTVVRRLSPFVRQVDFALDWVFLESGRAVY 381




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340711463|ref|XP_003394295.1| PREDICTED: neuropathy target esterase sws-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416248|ref|XP_003490887.1| PREDICTED: neuropathy target esterase sws-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350416245|ref|XP_003490886.1| PREDICTED: neuropathy target esterase sws-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711465|ref|XP_003394296.1| PREDICTED: neuropathy target esterase sws-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307205371|gb|EFN83712.1| Protein Swiss cheese [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307188193|gb|EFN73025.1| Protein Swiss cheese [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270002084|gb|EEZ98531.1| hypothetical protein TcasGA2_TC001035 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383848584|ref|XP_003699929.1| PREDICTED: neuropathy target esterase sws-like, partial [Megachile rotundata] Back     alignment and taxonomy information
>gi|328777223|ref|XP_001120383.2| PREDICTED: neuropathy target esterase sws [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
UNIPROTKB|H9KZH9 1070 PNPLA6 "Uncharacterized protei 0.649 0.142 0.393 1.9e-26
UNIPROTKB|E2RIR2 1366 PNPLA6 "Uncharacterized protei 0.726 0.124 0.373 2.9e-26
UNIPROTKB|Q8IY17 1366 PNPLA6 "Neuropathy target este 0.709 0.121 0.370 1.6e-25
UNIPROTKB|G3X6Z1 1302 LOC536255 "Uncharacterized pro 0.807 0.145 0.338 2.5e-25
UNIPROTKB|F1SCJ2 1365 PNPLA6 "Uncharacterized protei 0.709 0.121 0.358 6.9e-25
UNIPROTKB|Q5T362 1281 PNPLA7 "Patatin-like phospholi 0.807 0.147 0.343 8.4e-25
UNIPROTKB|Q6ZV29 1317 PNPLA7 "Patatin-like phospholi 0.807 0.143 0.343 8.7e-25
UNIPROTKB|E1BMJ5 1320 PNPLA6 "Uncharacterized protei 0.709 0.125 0.352 3.5e-24
UNIPROTKB|E2QXW6 1456 PNPLA7 "Uncharacterized protei 0.807 0.129 0.333 2.4e-23
RGD|1564611 1326 Pnpla6 "patatin-like phospholi 0.858 0.151 0.324 5.7e-23
UNIPROTKB|H9KZH9 PNPLA6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 1.9e-26, Sum P(2) = 1.9e-26
 Identities = 61/155 (39%), Positives = 96/155 (61%)

Query:    82 LIHSSKREFMEQLGVKDFSGLDIRV--EHIPGGTCLVREEVVEDNKLIYVIAGSLFITQK 139
             +  ++K+E ++ + V+D S L+ RV   H   GT + R+   +D  L +V+ G L + Q+
Sbjct:   337 IFEAAKQELVKLMKVEDPSLLNNRVLLHHAKAGTVIARQGD-QDVSLHFVLWGCLHVYQR 395

Query:   140 SSDGSNDVHLFTAFPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNV 199
               D + DV LF   PG+M+G LAVLTGE  +FTI++    T   + + D   ++    +V
Sbjct:   396 MIDKAEDVCLFLTQPGEMVGQLAVLTGEPLIFTIKANRDCTFLKISKSDFYEIMREQPSV 455

Query:   200 TLKIAHSVLKRMSPFVRQFDFALDWVFLEGGQAVY 234
              L +AH+V+ RMSPFVRQ DFA+DW+ +E G+A+Y
Sbjct:   456 VLSVAHTVVTRMSPFVRQMDFAIDWMAVEAGRALY 490


GO:0004622 "lysophospholipase activity" evidence=IEA
GO:0046470 "phosphatidylcholine metabolic process" evidence=IEA
GO:0001525 "angiogenesis" evidence=IEA
GO:0009887 "organ morphogenesis" evidence=IEA
UNIPROTKB|E2RIR2 PNPLA6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IY17 PNPLA6 "Neuropathy target esterase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6Z1 LOC536255 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCJ2 PNPLA6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T362 PNPLA7 "Patatin-like phospholipase domain-containing protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZV29 PNPLA7 "Patatin-like phospholipase domain-containing protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMJ5 PNPLA6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXW6 PNPLA7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1564611 Pnpla6 "patatin-like phospholipase domain containing 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 1e-12
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 4e-11
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 2e-08
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 7e-08
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 2e-06
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 2e-06
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 5e-05
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
 Score = 62.3 bits (152), Expect = 1e-12
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 3  DRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSEL 62
          D +DS YIVL+G +   K  E G+ +       GDL G + ++ +  R+ TV A+ DSEL
Sbjct: 33 DPADSLYIVLSGSVEVYKLDEDGREQIVGFLGPGDLFGELALLGNGPRSATVRALTDSEL 92

Query: 63 AKLP 66
            LP
Sbjct: 93 LVLP 96


In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115

>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 234
KOG1113|consensus368 99.95
KOG0614|consensus 732 99.94
KOG2968|consensus 1158 99.9
KOG2968|consensus 1158 99.81
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.73
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.73
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.72
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.69
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.68
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.68
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.66
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.63
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.6
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.58
cd00038115 CAP_ED effector domain of the CAP family of transc 99.58
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.54
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.53
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.52
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.51
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.5
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.5
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.41
COG2905 610 Predicted signal-transduction protein containing c 99.4
KOG1113|consensus368 99.39
cd00038115 CAP_ED effector domain of the CAP family of transc 99.37
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.37
KOG0498|consensus 727 99.36
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.36
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.32
KOG0614|consensus 732 99.26
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.25
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.23
PLN02868 413 acyl-CoA thioesterase family protein 99.22
KOG0500|consensus536 99.09
PLN02868 413 acyl-CoA thioesterase family protein 99.04
KOG0499|consensus 815 99.02
KOG0498|consensus727 98.87
KOG0499|consensus815 98.82
KOG0500|consensus536 98.77
COG2905 610 Predicted signal-transduction protein containing c 98.6
KOG0501|consensus 971 98.21
PRK11832207 putative DNA-binding transcriptional regulator; Pr 98.07
PF04831153 Popeye: Popeye protein conserved region; InterPro: 97.9
PRK11832207 putative DNA-binding transcriptional regulator; Pr 97.21
KOG0501|consensus 971 97.18
PF04831153 Popeye: Popeye protein conserved region; InterPro: 96.53
PRK11171266 hypothetical protein; Provisional 94.14
KOG3542|consensus 1283 93.52
PF0464813 MF_alpha: Yeast mating factor alpha hormone; Inter 93.51
KOG3542|consensus 1283 93.23
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 91.92
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 91.63
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 90.41
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 89.64
KOG2378|consensus 573 87.84
smart00835146 Cupin_1 Cupin. This family represents the conserve 87.1
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 86.32
smart00835146 Cupin_1 Cupin. This family represents the conserve 84.48
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 83.54
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 82.71
>KOG1113|consensus Back     alignment and domain information
Probab=99.95  E-value=2e-27  Score=190.80  Aligned_cols=187  Identities=18%  Similarity=0.208  Sum_probs=153.2

Q ss_pred             CCCCCCEEEEEEcceEEEEEEcCCCcEEEEEeecCCcEeeeeccccCCCceeEEEEccceeEEEeCccccccccCCCchH
Q psy8820           1 QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQ   80 (234)
Q Consensus         1 ~Gd~~~~~yii~~G~v~v~~~~~~g~~~~~~~~~~G~~fGe~~ll~~~~r~~tv~A~~~~~l~~i~~~~f~~l~~~~p~~   80 (234)
                      |||.||.||+|.+|++.|++..     ..+..++||.+|||+||+.+.||.||++|.+++.+|.+++..|..++..+.. 
T Consensus       159 qGdeGd~fYvI~kGt~dVyv~~-----~~v~~~~~g~sFGElALmyn~PRaATv~a~t~~klWgldr~SFrrIi~~s~~-  232 (368)
T KOG1113|consen  159 QGDEGDNFYVIDKGTFDVYVNG-----TYVTTYSPGGSFGELALMYNPPRAATVVAKSLKKLWGLDRTSFRRIIMKSCI-  232 (368)
T ss_pred             cCCcCCcEEEEecceEEEEECC-----eEEeeeCCCCchhhhHhhhCCCcccceeeccccceEEEeeceeEEEeeccch-
Confidence            7999999999999999999873     6789999999999999999999999999999999999999999998776541 


Q ss_pred             HHHHHHHHHHHHHhCC------CCCcccccee--eeecCCCEEEEecCCCCceEEEEEeCeEEEEEecCCCCccEEEEEE
Q psy8820          81 ELIHSSKREFMEQLGV------KDFSGLDIRV--EHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTA  152 (234)
Q Consensus        81 ~l~~~~~~~l~~~l~~------~~~~~l~~~~--~~~~~g~~i~~~~g~~~~~~y~I~~G~v~v~~~~~~g~~~~~~~~~  152 (234)
                      ...+.. ..+.+..++      .++.-+.+.+  +.|++|+.|..+ |++++.+|+|.+|++.+.... +|   ..+ .+
T Consensus       233 kkrkMy-~~~l~s~pil~~l~k~er~kv~dal~~k~y~~G~~Vi~q-g~~ge~f~~i~eGEvdv~~~~-~~---v~v-kl  305 (368)
T KOG1113|consen  233 KKRKMY-EPFLESVPILESLEKLERAKVADALGTKSYKDGERVIVQ-GDQGEHFYIIEEGEVDVLKKR-DG---VEV-KL  305 (368)
T ss_pred             hhhhhh-hhhhhcchhhHHHHHHHHHhhhcccceeeccCCceEEec-cCCcceEEEecccccchhhcc-CC---eEE-Ee
Confidence            111111 111111111      0111222333  899999999999 999999999999999998765 22   444 89


Q ss_pred             CCCceEEeeeeeeCcceEEEEEEcCCeEEEEeCHHhHHHHHhcchHHH
Q psy8820         153 FPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVT  200 (234)
Q Consensus       153 ~~g~~~G~~~~l~~~~~~~~v~A~~~~~~~~i~~~~~~~l~~~~p~~~  200 (234)
                      +.||+||+.+++.+.|+.++|.|..+..|..++++.|+.++.-...++
T Consensus       306 ~~~dyfge~al~~~~pr~Atv~a~~~~kc~~~dk~~ferllgpc~dil  353 (368)
T KOG1113|consen  306 KKGDYFGELALLKNLPRAATVVAKGRLKCAKLDKPRFERLLGPCQDIL  353 (368)
T ss_pred             chhhhcchHHHHhhchhhceeeccCCceeeeeChHHHHHHhhHHHHHH
Confidence            999999999999999999999999999999999999999998665544



>KOG0614|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PF04648 MF_alpha: Yeast mating factor alpha hormone; InterPro: IPR006742 This repeated sequence,WHWLQLKPGQPMY, characterises the mating factor alpha-1 or alpha-1 mating pheromone [contains: Mating factor alpha] Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>KOG2378|consensus Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 3e-08
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 2e-06
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 2e-07
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 2e-04
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 3e-07
2pqq_A149 Putative transcriptional regulator; APC7345, strep 3e-07
2pqq_A149 Putative transcriptional regulator; APC7345, strep 2e-04
4din_B381 CAMP-dependent protein kinase type I-beta regulat 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 9e-07
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 1e-06
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 2e-05
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 2e-06
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 4e-04
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 3e-06
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 4e-05
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 3e-06
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 1e-04
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 5e-06
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 6e-06
3b02_A195 Transcriptional regulator, CRP family; structural 7e-06
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 1e-05
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 1e-05
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 1e-05
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 1e-05
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 2e-04
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 1e-05
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 2e-05
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 2e-05
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 3e-05
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 4e-05
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 4e-05
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 4e-05
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 6e-05
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 7e-05
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 8e-05
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 2e-04
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
 Score = 50.9 bits (122), Expect = 3e-08
 Identities = 17/77 (22%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 3   DRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSEL 62
           D  D   ++LTG +  +K + +   +  A+   G ++G + M+    R+ + +A   ++ 
Sbjct: 78  DPGDYLLLILTGEVNVIKDIPNKGIQTIAKVGAGAIIGEMSMIDGMPRSASCVASLPTDF 137

Query: 63  AKLP-EGLCDHLPRSPS 78
           A L  + L   L   P 
Sbjct: 138 AVLSRDALYQLLANMPK 154


>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 100.0
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 100.0
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 100.0
4din_B381 CAMP-dependent protein kinase type I-beta regulat 100.0
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.98
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.95
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.95
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.82
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.8
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.79
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.79
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.77
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.76
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.76
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.75
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.75
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.75
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.74
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.74
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.74
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.74
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.74
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.73
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.73
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.73
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.72
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.72
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.71
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.71
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.71
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.7
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.7
3b02_A195 Transcriptional regulator, CRP family; structural 99.69
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.68
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.68
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.68
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.68
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.67
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.67
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.67
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.66
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.65
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.65
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.65
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.63
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.63
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.62
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.62
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.61
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.61
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.61
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.59
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.59
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.59
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.59
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.58
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.58
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.58
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.58
3b02_A195 Transcriptional regulator, CRP family; structural 99.57
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.56
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.56
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.56
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.55
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.55
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.55
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.54
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.53
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.52
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.52
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.51
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.51
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.5
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.48
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.48
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.47
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.47
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.47
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.46
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.46
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.46
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.44
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.43
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.41
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.4
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.37
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.35
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.3
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.15
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.13
3rns_A227 Cupin 2 conserved barrel domain protein; structura 96.92
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 94.95
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 92.74
1sfn_A246 Conserved hypothetical protein; structural genomic 92.63
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 92.29
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 92.15
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 89.62
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 88.53
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 87.62
3rns_A227 Cupin 2 conserved barrel domain protein; structura 86.6
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 86.57
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 86.39
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 86.22
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 85.48
3lwc_A119 Uncharacterized protein; structural genomics, unkn 84.55
4axo_A151 EUTQ, ethanolamine utilization protein; structural 80.85
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 80.41
3d82_A102 Cupin 2, conserved barrel domain protein; structur 80.29
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
Probab=100.00  E-value=1.4e-34  Score=237.61  Aligned_cols=208  Identities=15%  Similarity=0.165  Sum_probs=173.3

Q ss_pred             CCCCCCEEEEEEcceEEEEEEcCCCcEEEEEeecCCcEeeeeccccCCCceeEEEEccceeEEEeCccccccccCCCchH
Q psy8820           1 QYDRSDSTYIVLTGRLRSVKTLESGKRKEEAEYSKGDLVGLIEMVTSTSRNTTVMAVRDSELAKLPEGLCDHLPRSPSEQ   80 (234)
Q Consensus         1 ~Gd~~~~~yii~~G~v~v~~~~~~g~~~~~~~~~~G~~fGe~~ll~~~~r~~tv~A~~~~~l~~i~~~~f~~l~~~~p~~   80 (234)
                      |||+++.+|+|++|.|+++.   +|  ..+..+++|++|||.+++.+.||++|++|.++|+++.|+++.|..++...|. 
T Consensus        76 ~G~~~~~~yiI~~G~v~v~~---~g--~~~~~~~~G~~fGe~~ll~~~~~~~tv~a~~~~~l~~i~~~~~~~i~~~~~~-  149 (299)
T 3shr_A           76 EGDVGSLVYVMEDGKVEVTK---EG--VKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGL-  149 (299)
T ss_dssp             TTCBCCCEEEEEESCEEEEE---TT--EEEEEECTTCEESCSGGGTTTBCCSEEEESSCEEEEEECHHHHHHHHHHHHH-
T ss_pred             CCCcCceEEEEEEEEEEEEE---CC--EEEEEeCCCCeeeHhHHhcCCCCCcEEEEcCCeEEEEEcHHHHHHHhhHhHH-
Confidence            79999999999999999965   34  6788999999999999999999999999999999999999999999888773 


Q ss_pred             HHHHHHHHHHHH---HhCCCCC--ccccc--eeeeecCCCEEEEecCCCCceEEEEEeCeEEEEEec-CCCCccEEEEEE
Q psy8820          81 ELIHSSKREFME---QLGVKDF--SGLDI--RVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKS-SDGSNDVHLFTA  152 (234)
Q Consensus        81 ~l~~~~~~~l~~---~l~~~~~--~~l~~--~~~~~~~g~~i~~~~g~~~~~~y~I~~G~v~v~~~~-~~g~~~~~~~~~  152 (234)
                      .........+..   ...+.+.  ..+..  ..+.|++|++|+++ |+.++.+|+|++|.++++... .+| ++..+..+
T Consensus       150 ~~~~~~~~~l~~~~~f~~l~~~~l~~l~~~~~~~~~~~g~~I~~~-G~~~~~~yiI~~G~v~~~~~~~~~g-~~~~~~~l  227 (299)
T 3shr_A          150 IKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQ-GARGDTFFIISKGKVNVTREDSPNE-DPVFLRTL  227 (299)
T ss_dssp             HHHHHHHHHHTTSHHHHHSCHHHHHHHTTTCEEEEECTTCEEECT-TCEECEEEEEEESEEEEEECCSSSC-CCEEEEEE
T ss_pred             HHHHHHHHHHhhCHHhhhCCHHHHHHHHHhccEEEECCCCEEEeC-CCCCCEEEEEEeeEEEEEEecCCCC-cceEEEEc
Confidence            111111011100   0011111  11222  33899999999999 999999999999999999876 344 78899999


Q ss_pred             CCCceEEeeeeeeCcceEEEEEEcCCeEEEEeCHHhHHHHHhcchHHHHHHHHHHHHhhchhhh
Q psy8820         153 FPGDMIGGLAVLTGEASVFTIQSRLPATIAWLPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVR  216 (234)
Q Consensus       153 ~~g~~~G~~~~l~~~~~~~~v~A~~~~~~~~i~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~  216 (234)
                      ++|++||+.+++.+.|+.++++|.++|+++.|++++|.+++.++|.+..++.+.+.+|+.....
T Consensus       228 ~~G~~fGe~~ll~~~~~~~tv~a~~~~~l~~i~~~~f~~ll~~~p~~~~~~~~~l~~r~~~~~~  291 (299)
T 3shr_A          228 GKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE  291 (299)
T ss_dssp             ETTCEECGGGGSSSEECSSEEEESSSEEEEEEEHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCEeChHHHhCCCCcceEEEECCCEEEEEEeHHHHHHHHccHHHHHHHHHHHHhhhhhcchh
Confidence            9999999999999999999999999999999999999999999999999999999888776643



>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.82
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.82
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.82
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.8
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.8
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.8
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.8
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.78
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.76
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.75
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.7
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.7
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.69
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.68
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.66
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.66
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.66
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.66
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.63
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.63
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.62
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.62
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.62
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.62
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.62
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.61
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.6
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.57
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.56
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.56
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.48
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.47
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.45
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.43
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 97.51
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 94.46
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 94.37
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 91.43
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 91.18
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 90.13
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 89.05
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 88.98
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 88.7
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 88.39
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 88.24
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 85.7
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 85.2
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 84.18
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 83.02
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 82.87
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 82.75
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 82.34
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 82.2
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 80.99
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 80.51
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Catabolite gene activator protein, N-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=99.82  E-value=3.8e-20  Score=131.98  Aligned_cols=113  Identities=17%  Similarity=0.374  Sum_probs=102.9

Q ss_pred             eeeeecCCCEEEEecCCCCceEEEEEeCeEEEEEecCCCCccEEEEEECCCceEEeeeeee-CcceEEEEEEcCCeEEEE
Q psy8820         105 RVEHIPGGTCLVREEVVEDNKLIYVIAGSLFITQKSSDGSNDVHLFTAFPGDMIGGLAVLT-GEASVFTIQSRLPATIAW  183 (234)
Q Consensus       105 ~~~~~~~g~~i~~~~g~~~~~~y~I~~G~v~v~~~~~~g~~~~~~~~~~~g~~~G~~~~l~-~~~~~~~v~A~~~~~~~~  183 (234)
                      .++.|++|++|+++ |++++.+|+|++|.++++..+.+| ++.++..+.+|++||+.+++. +.++.++++|.++|+++.
T Consensus        14 ~~~~~~~g~~i~~~-g~~~~~iy~i~~G~v~~~~~~~~g-~e~~l~~~~~G~~~G~~~~~~~~~~~~~~~~a~~~~~v~~   91 (132)
T d1i5za2          14 HIHKYPSKSTLIHQ-GEKAETLYYIVKGSVAVLIKDEEG-KEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAE   91 (132)
T ss_dssp             EEEEECTTCEEECT-TSBCCEEEEEEECCEEEEEECTTC-CEEEEEEECTTCEESCTTTTSSSCBCCSEEEESSCEEEEE
T ss_pred             EEEEECcCCEEEcC-CCCCCEEEEEEEccceeeeccccc-hhhhhhhhCcccccchHHHhcCCccceEEEEEccceEEEE
Confidence            44799999999999 999999999999999999888777 789999999999999988886 577889999999999999


Q ss_pred             eCHHhHHHHHhcchHHHHHHHHHHHHhhchhhhhcc
Q psy8820         184 LPQDDCSTLIDADMNVTLKIAHSVLKRMSPFVRQFD  219 (234)
Q Consensus       184 i~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~  219 (234)
                      ||++.|.++++++|.+..++++.+.+|+....+++.
T Consensus        92 i~~~~~~~~~~~~~~~~~~~~~~l~~rl~~~~~~i~  127 (132)
T d1i5za2          92 ISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVG  127 (132)
T ss_dssp             EEHHHHHHHHHHCTHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EcHHHHHHHHhhCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999888877655544



>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure