Diaphorina citri psyllid: psy8829


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHcccccccccHHHHHHHccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccc
*******GAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Catalase Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells including T-cells, B-cells, myeloid leukemia cells, melanoma cells, mastocytoma cells and normal and transformed fibroblast cells.confidentP04040
Catalase Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells.confidentO97492
Catalase Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells.confidentP24270

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0004096 [MF]catalase activityprobableGO:0016209, GO:0003824, GO:0003674, GO:0016684, GO:0004601, GO:0016491
GO:0009411 [BP]response to UVprobableGO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0046688 [BP]response to copper ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0020037 [MF]heme bindingprobableGO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0032088 [BP]negative regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0014068 [BP]positive regulation of phosphatidylinositol 3-kinase cascadeprobableGO:0010646, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0014066, GO:0050789, GO:0048522
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0019166 [MF]trans-2-enoyl-CoA reductase (NADPH) activityprobableGO:0003824, GO:0016627, GO:0003674, GO:0016628, GO:0016491
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0042744 [BP]hydrogen peroxide catabolic processprobableGO:0000302, GO:0044248, GO:0042743, GO:0070887, GO:0044699, GO:0051716, GO:0070301, GO:0009987, GO:0034614, GO:0072593, GO:0006950, GO:0008150, GO:0008152, GO:0042221, GO:0034599, GO:0010035, GO:0009056, GO:0006979, GO:1901700, GO:1901701, GO:0042542, GO:0050896, GO:0044237, GO:0033554, GO:0044763
GO:0009277 [CC]fungal-type cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944
GO:0046914 [MF]transition metal ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0051092 [BP]positive regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051091, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0050661 [MF]NADP bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EJ6, chain A
Confidence level:very confident
Coverage over the Query: 70-205
View the alignment between query and template
View the model in PyMOL
Template: 2ISA, chain A
Confidence level:very confident
Coverage over the Query: 1-101
View the alignment between query and template
View the model in PyMOL