Psyllid ID: psy8829

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHcccccccccHHHHHHHccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccc
ccccccccccccccccccccEccHHHccccEEcccEEEEcccccccccHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHcHHHcccccccccccccccccccccccccccccccccccEccHHHccccEEcccEEEEcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHH
maidnqngapnyypnsfkgpeptprgawstynatgdvkryktedednfsqprilwsNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRlganfnqipvncpyrvrvanyqrdapmaidnqngapnyypnsfkgpeptprgawstynatgdvkryktedednfsqprilwsNVLDDAARDRMTTNIASVLKLAAPFIQ
maidnqngapnyypnsfkgpeptprgAWSTYNATGDVKRYktedednfsqpriLWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYktedednfsqpriLWSNVLDDAARDRMTTNIASVLKLAAPFIQ
MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ
*************************************************QPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPM*****************************Y*******************PRILWSNVLDDAARDRMTTNIASVLKLA*****
MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ
********APNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ
*******GAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAP*IQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query205 2.2.26 [Sep-21-2011]
Q9PT92526 Catalase OS=Danio rerio G yes N/A 0.609 0.237 0.571 4e-35
Q9PWF7528 Catalase OS=Glandirana ru N/A N/A 0.604 0.234 0.568 1e-34
O62839527 Catalase OS=Sus scrofa GN yes N/A 0.604 0.235 0.568 5e-34
Q2I6W4527 Catalase OS=Callithrix ja yes N/A 0.609 0.237 0.555 9e-34
Q5RF10527 Catalase OS=Pongo abelii yes N/A 0.609 0.237 0.547 1e-33
P04040527 Catalase OS=Homo sapiens yes N/A 0.609 0.237 0.547 1e-33
Q64405527 Catalase OS=Cavia porcell yes N/A 0.609 0.237 0.555 2e-33
P00432527 Catalase OS=Bos taurus GN yes N/A 0.609 0.237 0.547 3e-33
P04762527 Catalase OS=Rattus norveg yes N/A 0.609 0.237 0.547 5e-33
P24270527 Catalase OS=Mus musculus yes N/A 0.609 0.237 0.547 6e-33
>sp|Q9PT92|CATA_DANRE Catalase OS=Danio rerio GN=cat PE=2 SV=1 Back     alignment and function desciption
 Score =  147 bits (372), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 88/126 (69%), Gaps = 1/126 (0%)

Query: 81  FIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAI-DNQNGAPNYYPNSF 139
            +QGRL SY DTH HRLGAN+ Q+PVNCPYR RVANYQRD PM + DNQ GAPNYYPNSF
Sbjct: 350 MLQGRLFSYPDTHRHRLGANYLQLPVNCPYRTRVANYQRDGPMCMHDNQGGAPNYYPNSF 409

Query: 140 KGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKL 199
             P+  PR   S    + DV RY + D+DN +Q R  ++ VL++A R+R+  N+A  LK 
Sbjct: 410 SAPDVQPRFLESKCKVSPDVARYNSADDDNVTQVRTFFTQVLNEAERERLCQNMAGHLKG 469

Query: 200 AAPFIQ 205
           A  FIQ
Sbjct: 470 AQLFIQ 475
Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide.
Danio rerio (taxid: 7955)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 6
>sp|Q9PWF7|CATA_GLARU Catalase OS=Glandirana rugosa GN=cat PE=2 SV=3 Back     alignment and function description
>sp|O62839|CATA_PIG Catalase OS=Sus scrofa GN=CAT PE=1 SV=4 Back     alignment and function description
>sp|Q2I6W4|CATA_CALJA Catalase OS=Callithrix jacchus GN=CAT PE=2 SV=3 Back     alignment and function description
>sp|Q5RF10|CATA_PONAB Catalase OS=Pongo abelii GN=CAT PE=2 SV=3 Back     alignment and function description
>sp|P04040|CATA_HUMAN Catalase OS=Homo sapiens GN=CAT PE=1 SV=3 Back     alignment and function description
>sp|Q64405|CATA_CAVPO Catalase OS=Cavia porcellus GN=CAT PE=2 SV=4 Back     alignment and function description
>sp|P00432|CATA_BOVIN Catalase OS=Bos taurus GN=CAT PE=1 SV=3 Back     alignment and function description
>sp|P04762|CATA_RAT Catalase OS=Rattus norvegicus GN=Cat PE=1 SV=3 Back     alignment and function description
>sp|P24270|CATA_MOUSE Catalase OS=Mus musculus GN=Cat PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query205
304367635 501 catalase [Polypedilum vanderplanki] 0.604 0.247 0.595 6e-37
157135803 505 catalase [Aedes aegypti] gi|108870108|gb 0.604 0.245 0.596 2e-36
409690331 508 catalase [Reticulitermes flavipes] 0.604 0.244 0.584 1e-35
403183360 504 AAEL013407-PB [Aedes aegypti] 0.604 0.246 0.554 1e-35
348015181 507 catalase [Spodoptera exigua] 0.604 0.244 0.606 2e-35
94468602 428 catalase [Aedes aegypti] 0.604 0.289 0.554 2e-35
164459608 497 catalase [Belgica antarctica] 0.604 0.249 0.606 2e-35
382934505 507 catalase [Spodoptera litura] 0.604 0.244 0.598 4e-35
348520104 527 PREDICTED: catalase-like isoform 1 [Oreo 0.604 0.235 0.576 6e-35
348520108 463 PREDICTED: catalase-like isoform 3 [Oreo 0.609 0.269 0.571 6e-35
>gi|304367635|gb|ADM26625.1| catalase [Polypedilum vanderplanki] Back     alignment and taxonomy information
 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 75/126 (59%), Positives = 89/126 (70%), Gaps = 2/126 (1%)

Query: 82  IQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKG 141
           +QGRL SY+DTH HRLGAN+  +PVNCPYRV + NYQRD PM  D+Q  APNYYPNSF G
Sbjct: 346 LQGRLFSYVDTHRHRLGANYQMLPVNCPYRVSIKNYQRDGPMCFDSQGNAPNYYPNSFGG 405

Query: 142 PEPTPRGA--WSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKL 199
           PEP  R       Y  +G+V RY + DEDN+SQ  + W+NVLD+ AR+RM  NIA  L  
Sbjct: 406 PEPIKRAVDLQPPYKVSGEVFRYDSADEDNYSQATLFWNNVLDEPARNRMVENIAGHLVN 465

Query: 200 AAPFIQ 205
           AA FIQ
Sbjct: 466 AAEFIQ 471

Source: Polypedilum vanderplanki

Species: Polypedilum vanderplanki

Genus: Polypedilum

Family: Chironomidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157135803|ref|XP_001663600.1| catalase [Aedes aegypti] gi|108870108|gb|EAT34333.1| AAEL013407-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|409690331|gb|AFV36369.1| catalase [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|403183360|gb|EJY58037.1| AAEL013407-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|348015181|gb|AEP40969.1| catalase [Spodoptera exigua] Back     alignment and taxonomy information
>gi|94468602|gb|ABF18150.1| catalase [Aedes aegypti] Back     alignment and taxonomy information
>gi|164459608|gb|ABY57911.1| catalase [Belgica antarctica] Back     alignment and taxonomy information
>gi|382934505|gb|AFG31725.1| catalase [Spodoptera litura] Back     alignment and taxonomy information
>gi|348520104|ref|XP_003447569.1| PREDICTED: catalase-like isoform 1 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|348520108|ref|XP_003447571.1| PREDICTED: catalase-like isoform 3 [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query205
ZFIN|ZDB-GENE-000210-20526 cat "catalase" [Danio rerio (t 0.604 0.235 0.576 7.2e-36
UNIPROTKB|P00432527 CAT "Catalase" [Bos taurus (ta 0.604 0.235 0.552 1.3e-33
RGD|2279527 Cat "catalase" [Rattus norvegi 0.604 0.235 0.552 3.2e-33
UNIPROTKB|F1NGJ7528 CAT "Catalase" [Gallus gallus 0.604 0.234 0.584 3.6e-33
MGI|MGI:88271527 Cat "catalase" [Mus musculus ( 0.604 0.235 0.552 4.2e-33
UNIPROTKB|O62839527 CAT "Catalase" [Sus scrofa (ta 0.604 0.235 0.568 2.4e-32
UNIPROTKB|P04040527 CAT "Catalase" [Homo sapiens ( 0.624 0.242 0.541 3.2e-32
UNIPROTKB|Q64405527 CAT "Catalase" [Cavia porcellu 0.604 0.235 0.56 3.2e-32
UNIPROTKB|F1SGS9527 CAT "Catalase" [Sus scrofa (ta 0.604 0.235 0.56 7.2e-32
FB|FBgn0000261506 Cat "Catalase" [Drosophila mel 0.604 0.245 0.546 2.3e-31
ZFIN|ZDB-GENE-000210-20 cat "catalase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 7.2e-36, Sum P(2) = 7.2e-36
 Identities = 72/125 (57%), Positives = 88/125 (70%)

Query:    82 IQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAI-DNQNGAPNYYPNSFK 140
             +QGRL SY DTH HRLGAN+ Q+PVNCPYR RVANYQRD PM + DNQ GAPNYYPNSF 
Sbjct:   351 LQGRLFSYPDTHRHRLGANYLQLPVNCPYRTRVANYQRDGPMCMHDNQGGAPNYYPNSFS 410

Query:   141 GPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLA 200
              P+  PR   S    + DV RY + D+DN +Q R  ++ VL++A R+R+  N+A  LK A
Sbjct:   411 APDVQPRFLESKCKVSPDVARYNSADDDNVTQVRTFFTQVLNEAERERLCQNMAGHLKGA 470

Query:   201 APFIQ 205
               FIQ
Sbjct:   471 QLFIQ 475
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004096 "catalase activity" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IEA
GO:0046688 "response to copper ion" evidence=IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0042744 "hydrogen peroxide catabolic process" evidence=IEA
GO:0004601 "peroxidase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005777 "peroxisome" evidence=IEA
UNIPROTKB|P00432 CAT "Catalase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|2279 Cat "catalase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGJ7 CAT "Catalase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:88271 Cat "catalase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O62839 CAT "Catalase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P04040 CAT "Catalase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q64405 CAT "Catalase" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGS9 CAT "Catalase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0000261 Cat "Catalase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q64405CATA_CAVPO1, ., 1, 1, ., 1, ., 60.55550.60970.2371yesN/A
Q5RF10CATA_PONAB1, ., 1, 1, ., 1, ., 60.54760.60970.2371yesN/A
O97492CATA_CANFA1, ., 1, 1, ., 1, ., 60.53170.60970.2371yesN/A
P24270CATA_MOUSE1, ., 1, 1, ., 1, ., 60.54760.60970.2371yesN/A
P00432CATA_BOVIN1, ., 1, 1, ., 1, ., 60.54760.60970.2371yesN/A
Q27487CATA1_CAEEL1, ., 1, 1, ., 1, ., 60.52840.59510.244yesN/A
P17336CATA_DROME1, ., 1, 1, ., 1, ., 60.53900.60480.2450yesN/A
P04762CATA_RAT1, ., 1, 1, ., 1, ., 60.54760.60970.2371yesN/A
P04040CATA_HUMAN1, ., 1, 1, ., 1, ., 60.54760.60970.2371yesN/A
Q2I6W4CATA_CALJA1, ., 1, 1, ., 1, ., 60.55550.60970.2371yesN/A
Q9PT92CATA_DANRE1, ., 1, 1, ., 1, ., 60.57140.60970.2376yesN/A
O62839CATA_PIG1, ., 1, 1, ., 1, ., 60.5680.60480.2352yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.11.1.6LOW CONFIDENCE prediction!
3rd Layer1.11.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query205
cd08156429 cd08156, catalase_clade_3, Clade 3 of the heme-bin 2e-47
COG0753496 COG0753, KatE, Catalase [Inorganic ion transport a 6e-33
cd08157451 cd08157, catalase_fungal, Fungal catalases similar 1e-27
cd00328433 cd00328, catalase, Catalase heme-binding enzyme 1e-22
cd08156429 cd08156, catalase_clade_3, Clade 3 of the heme-bin 3e-22
cd08154469 cd08154, catalase_clade_1, Clade 1 of the heme-bin 9e-22
smart01060373 smart01060, Catalase, Catalases are antioxidant en 1e-21
pfam00199383 pfam00199, Catalase, Catalase 1e-18
cd08155443 cd08155, catalase_clade_2, Clade 2 of the heme-bin 1e-18
PRK11249 752 PRK11249, katE, hydroperoxidase II; Provisional 2e-18
PLN02609492 PLN02609, PLN02609, catalase 1e-16
COG0753496 COG0753, KatE, Catalase [Inorganic ion transport a 4e-11
cd08157451 cd08157, catalase_fungal, Fungal catalases similar 8e-08
pfam0662868 pfam06628, Catalase-rel, Catalase-related immune-r 2e-07
pfam0662868 pfam06628, Catalase-rel, Catalase-related immune-r 3e-07
cd08154469 cd08154, catalase_clade_1, Clade 1 of the heme-bin 2e-04
PLN02609492 PLN02609, PLN02609, catalase 6e-04
>gnl|CDD|163712 cd08156, catalase_clade_3, Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information 
 Score =  160 bits (407), Expect = 2e-47
 Identities = 59/125 (47%), Positives = 74/125 (59%), Gaps = 4/125 (3%)

Query: 83  QGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAID-NQNGAPNYYPNSFKG 141
           QGRL SY D H +RLG N++Q+PVN P    V NYQRD  M +D N  GAPNY PNSF G
Sbjct: 285 QGRLFSYADAHRYRLGVNYHQLPVNRPK-CPVNNYQRDGAMRVDGNGGGAPNYEPNSFGG 343

Query: 142 PEPTPRGAWSTYNATGDVKRYKT-EDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLA 200
           P   P  A      +GD  RY   +D+D+++Q   L+  V  +  R+R+  NIA  LK A
Sbjct: 344 PPEDPEYAEPPLPVSGDADRYNYRDDDDDYTQAGDLYRLV-SEDERERLVENIAGHLKGA 402

Query: 201 APFIQ 205
             FIQ
Sbjct: 403 PEFIQ 407

Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 3 catalases are the most abundant subfamily and are found in all three kingdoms of life; they have a relatively small subunit size of 43 to 75 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. Clade 3 catalases also bind NADPH as a second redox-active cofactor. They form tetramers, and in eukaryotic cells, catalases are located in peroxisomes. Length = 429
>gnl|CDD|223824 COG0753, KatE, Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163713 cd08157, catalase_fungal, Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>gnl|CDD|163705 cd00328, catalase, Catalase heme-binding enzyme Back     alignment and domain information
>gnl|CDD|163712 cd08156, catalase_clade_3, Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|163710 cd08154, catalase_clade_1, Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|215003 smart01060, Catalase, Catalases are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects Back     alignment and domain information
>gnl|CDD|215783 pfam00199, Catalase, Catalase Back     alignment and domain information
>gnl|CDD|163711 cd08155, catalase_clade_2, Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|236886 PRK11249, katE, hydroperoxidase II; Provisional Back     alignment and domain information
>gnl|CDD|215328 PLN02609, PLN02609, catalase Back     alignment and domain information
>gnl|CDD|223824 COG0753, KatE, Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163713 cd08157, catalase_fungal, Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>gnl|CDD|219112 pfam06628, Catalase-rel, Catalase-related immune-responsive Back     alignment and domain information
>gnl|CDD|219112 pfam06628, Catalase-rel, Catalase-related immune-responsive Back     alignment and domain information
>gnl|CDD|163710 cd08154, catalase_clade_1, Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|215328 PLN02609, PLN02609, catalase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 205
KOG0047|consensus505 100.0
cd08156429 catalase_clade_3 Clade 3 of the heme-binding enzym 100.0
cd08154469 catalase_clade_1 Clade 1 of the heme-binding enzym 100.0
cd08155443 catalase_clade_2 Clade 2 of the heme-binding enzym 99.97
PLN02609492 catalase 99.97
COG0753496 KatE Catalase [Inorganic ion transport and metabol 99.97
cd08157451 catalase_fungal Fungal catalases similar to yeast 99.97
cd00328433 catalase Catalase heme-binding enzyme. Catalase is 99.97
PRK11249 752 katE hydroperoxidase II; Provisional 99.96
cd08156429 catalase_clade_3 Clade 3 of the heme-binding enzym 99.82
cd08154469 catalase_clade_1 Clade 1 of the heme-binding enzym 99.81
cd08155443 catalase_clade_2 Clade 2 of the heme-binding enzym 99.78
cd08157451 catalase_fungal Fungal catalases similar to yeast 99.77
PLN02609492 catalase 99.75
KOG0047|consensus505 99.75
cd00328433 catalase Catalase heme-binding enzyme. Catalase is 99.73
PF0662868 Catalase-rel: Catalase-related immune-responsive; 99.7
COG0753496 KatE Catalase [Inorganic ion transport and metabol 99.68
PRK11249752 katE hydroperoxidase II; Provisional 99.66
PF00199384 Catalase: Catalase; InterPro: IPR011614 Catalases 99.57
PF0662868 Catalase-rel: Catalase-related immune-responsive; 99.36
>KOG0047|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.1e-35  Score=259.15  Aligned_cols=133  Identities=53%  Similarity=0.887  Sum_probs=121.3

Q ss_pred             hccccchHHHHHHHHhhhhhhcccccccCCCcccCCCcccccCCcccCCCccc-cCCCCCCcccCCCCCCCCCCCC-CCC
Q psy8829          73 SVLKLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAI-DNQNGAPNYYPNSFKGPEPTPR-GAW  150 (205)
Q Consensus        73 ~~L~~~d~~Iq~R~~sy~d~~~~~LG~n~~~~pvN~P~~~~~~~~~rDG~m~~-~n~~~~~nY~pn~~~~~~~~~~-~~~  150 (205)
                      |...++|++||.|+|+|.|++++|||+||.|||||||+...++|+||||+|++ +|+|++|||+||++.+++..+. +.+
T Consensus       339 GIe~S~Dk~LQ~RlFSY~DthRHRLGpNy~QlPVNcPy~~~~~n~qrDG~Mn~~~nqg~~pNYfpn~~~~~~~~~~~~~~  418 (505)
T KOG0047|consen  339 GIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPYRVRAHNFQRDGPMNVNDNQGGAPNYFPNSFSGPRQQPDPVLE  418 (505)
T ss_pred             CcccCCchhheeeeeccCcccccccCCCeeecccCCCccccccccccCCceeeccCCCCCCCcCcccCCccccCCccccC
Confidence            33446899999999999999999999999999999999434899999999999 9999999999999998888774 667


Q ss_pred             CCceeecceeecccCCCCCccchHHHHHhcCCHHHHHHHHHHHHHHhccCCcccC
Q psy8829         151 STYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ  205 (205)
Q Consensus       151 ~~~~~~g~~~~~~~~~~~df~Q~~~~~~~~~~~~~~~~l~~n~~~~l~~~~~~i~  205 (205)
                      +...++|.+.++.+.+++||+|||+||++++++.+|+|||.||++||+++.++||
T Consensus       419 ~~~~~~G~~yr~~~~~d~nf~Qpr~fy~~vl~~~q~kr~v~n~~~hl~~~~~~iq  473 (505)
T KOG0047|consen  419 HTEVASGDVYRYEIGDDNNFEQPRAFYEKVLDKEQQKRLVQNIAGHLSEARDFIQ  473 (505)
T ss_pred             CceeeecceEEeeccCcccccchHHHHHHHhcHHHHHHHHHHHHHHhhcchHHHH
Confidence            7788999999998888999999999999999999999999999999999987764

>cd08156 catalase_clade_3 Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information
>cd08154 catalase_clade_1 Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>cd08155 catalase_clade_2 Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information
>PLN02609 catalase Back     alignment and domain information
>COG0753 KatE Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08157 catalase_fungal Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>cd00328 catalase Catalase heme-binding enzyme Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd08156 catalase_clade_3 Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information
>cd08154 catalase_clade_1 Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>cd08155 catalase_clade_2 Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information
>cd08157 catalase_fungal Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>PLN02609 catalase Back     alignment and domain information
>KOG0047|consensus Back     alignment and domain information
>cd00328 catalase Catalase heme-binding enzyme Back     alignment and domain information
>PF06628 Catalase-rel: Catalase-related immune-responsive; InterPro: IPR010582 Catalases (1 Back     alignment and domain information
>COG0753 KatE Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>PF00199 Catalase: Catalase; InterPro: IPR011614 Catalases (1 Back     alignment and domain information
>PF06628 Catalase-rel: Catalase-related immune-responsive; InterPro: IPR010582 Catalases (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query205
1qqw_A527 Crystal Structure Of Human Erythrocyte Catalase Len 1e-34
1dgh_B498 Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole C 2e-34
1dgh_A498 Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole C 2e-34
1dgg_A497 Human Erythrocyte Catalse Cyanide Complex Length = 2e-34
3nwl_A527 The Crystal Structure Of The P212121 Form Of Bovine 2e-34
7cat_A506 The Nadph Binding Site On Beef Liver Catalase Lengt 3e-34
3rgp_A499 Structural And Kinetic Analysis Of The Beef Liver C 3e-34
2xq1_A509 Crystal Structure Of Peroxisomal Catalase From The 6e-15
1si8_A484 Crystal Structure Of E. Faecalis Catalase Length = 7e-15
1h7k_A483 Formation Of A Tyrosyl Radical Intermediate In Prot 1e-14
1e93_A484 High Resolution Structure And Biochemical Propertie 1e-14
1h6n_A484 Formation Of A Tyrosyl Radical Intermediate In Prot 1e-14
1m85_A484 Structure Of Proteus Mirabilis Catalase For The Nat 1e-14
3hb6_A484 Inactive Mutant H54f Of Proteus Mirabilis Catalase 1e-14
2j2m_A491 Crystal Structure Analysis Of Catalase From Exiguob 1e-13
1sy7_A 715 Crystal Structure Of The Catalase-1 From Neurospora 1e-10
3ttu_A 753 Structure Of F413y/h128n Double Variant Of E. Coli 2e-10
3ttv_A 753 Structure Of The F413e Variant Of E. Coli Kate Leng 2e-10
3ttt_A 753 Structure Of F413y Variant Of E. Coli Kate Length = 2e-10
3ttw_A 753 Structure Of The F413e Variant Of E. Coli Kate Leng 3e-10
4enp_A 753 Structure Of E530a Variant E. Coli Kate Length = 75 4e-10
3ttx_A 753 Structure Of The F413k Variant Of E. Coli Kate Leng 4e-10
1ggj_A 753 Crystal Structure Of Catalase Hpii From Escherichia 4e-10
3p9r_A 753 Structure Of I274g Variant Of E. Coli Kate Length = 4e-10
1ggh_A 753 Crystal Structure Of Catalase Hpii From Escherichia 4e-10
1gg9_A 753 Crystal Structure Of Catalase Hpii From Escherichia 4e-10
3p9s_A 753 Structure Of I274a Variant Of E. Coli Kate Length = 4e-10
1qws_A 753 Structure Of The D181n Variant Of Catalase Hpii Fro 4e-10
1p7y_A 753 Crystal Structure Of The D181a Variant Of Catalase 4e-10
4ent_A 753 Structure Of The S234a Variant Of E. Coli Kate Leng 4e-10
1p81_A 753 Crystal Structure Of The D181e Variant Of Catalase 4e-10
1qf7_A 753 Structure Of The Mutant His392gln Of Catalase Hpii 4e-10
1iph_A 753 Structure Of Catalase Hpii From Escherichia Coli Le 4e-10
3p9p_A 753 Structure Of I274v Variant Of E. Coli Kate Length = 4e-10
1ggk_A 753 Crystal Structure Of Catalase Hpii From Escherichia 4e-10
1p80_A 753 Crystal Structure Of The D181q Variant Of Catalase 4e-10
1p7z_A 753 Crystal Structure Of The D181s Variant Of Catalase 4e-10
4enq_A 753 Structure Of E530d Variant E. Coli Kate Length = 75 4e-10
1cf9_A 753 Structure Of The Mutant Val169cys Of Catalase Hpii 4e-10
4enw_A 753 Structure Of The S234n Variant Of E. Coli Kate Leng 4e-10
4enr_A 753 Structure Of E530i Variant E. Coli Kate Length = 75 4e-10
4enu_A 753 Structure Of The S234d Variant Of E. Coli Kate Leng 4e-10
4ens_A 753 Structure Of E530q Variant Of E. Coli Kate Length = 4e-10
4env_A 753 Structure Of The S234i Variant Of E. Coli Kate Leng 4e-10
1ye9_E259 Crystal Structure Of Proteolytically Truncated Cata 6e-10
1a4e_A488 Catalase A From Saccharomyces Cerevisiae Length = 4 3e-09
3p9q_A 753 Structure Of I274c Variant Of E. Coli Kate Length = 7e-09
2isa_A483 Crystal Structure Of Vibrio Salmonicida Catalase Le 8e-09
2xf2_A 688 Pvc-At Length = 688 4e-08
2iuf_A 688 The Structures Of Penicillium Vitale Catalase: Rest 4e-08
1m7s_A484 Crystal Structure Analysis Of Catalase Catf Of Pseu 1e-07
1gwh_A503 Atomic Resolution Structure Of Micrococcus Lysodeik 3e-07
1hbz_A498 Catalase From Micrococcus Lysodeikticu Length = 498 3e-07
1qwl_A505 Structure Of Helicobacter Pylori Catalase Length = 5e-07
4aul_A 719 Crystal Structure, Recombinant Expression And Mutag 1e-06
4aue_A 717 Crystal Structure, Recombinant Expression And Mutag 1e-06
4aun_A 719 Crystal Structure, Recombinant Expression And Mutag 2e-06
4aum_A 719 Crystal Structure, Recombinant Expression And Mutag 2e-06
1gwf_A503 Compound Ii Structure Of Micrococcus Lysodeikticus 2e-06
2a9e_A505 Helicobacter Pylori Catalase Compound I Length = 50 3e-06
3ej6_A 688 Neurospora Crassa Catalase-3 Crystal Structure Leng 2e-05
>pdb|1QQW|A Chain A, Crystal Structure Of Human Erythrocyte Catalase Length = 527 Back     alignment and structure 
Iteration: 1

 Score =  142 bits (359), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 85/126 (67%), Gaps = 1/126 (0%)
Query: 81  FIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAI-DNQNGAPNYYPNSF 139
            +QGRL +Y DTH HRLG N+  IPVNCPYR RVANYQRD PM + DNQ GAPNYYPNSF
Sbjct: 350 MLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSF 409
Query: 140 KGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKL 199
             PE  P     +   +G+V+R+ T ++DN +Q R  + NVL++  R R+  NIA  LK 
Sbjct: 410 GAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKD 469
Query: 200 AAPFIQ 205
           A  FIQ
Sbjct: 470 AQIFIQ 475
>pdb|1DGH|B Chain B, Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole Complex Length = 498 Back     alignment and structure
>pdb|1DGH|A Chain A, Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole Complex Length = 498 Back     alignment and structure
>pdb|1DGG|A Chain A, Human Erythrocyte Catalse Cyanide Complex Length = 497 Back     alignment and structure
>pdb|3NWL|A Chain A, The Crystal Structure Of The P212121 Form Of Bovine Liver Catalase Previously Characterized By Electron Microscopy Length = 527 Back     alignment and structure
>pdb|7CAT|A Chain A, The Nadph Binding Site On Beef Liver Catalase Length = 506 Back     alignment and structure
>pdb|3RGP|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase Complexed With Nitric Oxide Length = 499 Back     alignment and structure
>pdb|2XQ1|A Chain A, Crystal Structure Of Peroxisomal Catalase From The Yeast Hansenula Polymorpha Length = 509 Back     alignment and structure
>pdb|1SI8|A Chain A, Crystal Structure Of E. Faecalis Catalase Length = 484 Back     alignment and structure
>pdb|1H7K|A Chain A, Formation Of A Tyrosyl Radical Intermediate In Proteus Mirabilis Catalase By Directed Mutagenesis And Consequences For Nucleotide Reactivity Length = 483 Back     alignment and structure
>pdb|1E93|A Chain A, High Resolution Structure And Biochemical Properties Of A Recombinant Catalase Depleted In Iron Length = 484 Back     alignment and structure
>pdb|1H6N|A Chain A, Formation Of A Tyrosyl Radical Intermediate In Proteus Mirabilis Catalase By Directed Mutagenesis And Consequences For Nucleotide Reactivity Length = 484 Back     alignment and structure
>pdb|1M85|A Chain A, Structure Of Proteus Mirabilis Catalase For The Native Form Length = 484 Back     alignment and structure
>pdb|3HB6|A Chain A, Inactive Mutant H54f Of Proteus Mirabilis Catalase Length = 484 Back     alignment and structure
>pdb|2J2M|A Chain A, Crystal Structure Analysis Of Catalase From Exiguobacterium Oxidotolerans Length = 491 Back     alignment and structure
>pdb|1SY7|A Chain A, Crystal Structure Of The Catalase-1 From Neurospora Crassa, Native Structure At 1.75a Resolution. Length = 715 Back     alignment and structure
>pdb|3TTU|A Chain A, Structure Of F413y/h128n Double Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTV|A Chain A, Structure Of The F413e Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTT|A Chain A, Structure Of F413y Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTW|A Chain A, Structure Of The F413e Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENP|A Chain A, Structure Of E530a Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTX|A Chain A, Structure Of The F413k Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GGJ|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, Asn201ala Variant. Length = 753 Back     alignment and structure
>pdb|3P9R|A Chain A, Structure Of I274g Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GGH|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, His128ala Variant. Length = 753 Back     alignment and structure
>pdb|1GG9|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, His128asn Variant. Length = 753 Back     alignment and structure
>pdb|3P9S|A Chain A, Structure Of I274a Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1QWS|A Chain A, Structure Of The D181n Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P7Y|A Chain A, Crystal Structure Of The D181a Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|4ENT|A Chain A, Structure Of The S234a Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1P81|A Chain A, Crystal Structure Of The D181e Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1QF7|A Chain A, Structure Of The Mutant His392gln Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1IPH|A Chain A, Structure Of Catalase Hpii From Escherichia Coli Length = 753 Back     alignment and structure
>pdb|3P9P|A Chain A, Structure Of I274v Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GGK|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, Asn201his Variant. Length = 753 Back     alignment and structure
>pdb|1P80|A Chain A, Crystal Structure Of The D181q Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P7Z|A Chain A, Crystal Structure Of The D181s Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|4ENQ|A Chain A, Structure Of E530d Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1CF9|A Chain A, Structure Of The Mutant Val169cys Of Catalase Hpii From Escherichia Coli Length = 753 Back     alignment and structure
>pdb|4ENW|A Chain A, Structure Of The S234n Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENR|A Chain A, Structure Of E530i Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENU|A Chain A, Structure Of The S234d Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENS|A Chain A, Structure Of E530q Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENV|A Chain A, Structure Of The S234i Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1YE9|E Chain E, Crystal Structure Of Proteolytically Truncated Catalase Hpii From E. Coli Length = 259 Back     alignment and structure
>pdb|1A4E|A Chain A, Catalase A From Saccharomyces Cerevisiae Length = 488 Back     alignment and structure
>pdb|3P9Q|A Chain A, Structure Of I274c Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|2ISA|A Chain A, Crystal Structure Of Vibrio Salmonicida Catalase Length = 483 Back     alignment and structure
>pdb|2XF2|A Chain A, Pvc-At Length = 688 Back     alignment and structure
>pdb|2IUF|A Chain A, The Structures Of Penicillium Vitale Catalase: Resting State, Oxidised State (Compound I) And Complex With Aminotriazole Length = 688 Back     alignment and structure
>pdb|1M7S|A Chain A, Crystal Structure Analysis Of Catalase Catf Of Pseudomonas Syringae Length = 484 Back     alignment and structure
>pdb|1GWH|A Chain A, Atomic Resolution Structure Of Micrococcus Lysodeikticus Catalase Complexed With Nadph Length = 503 Back     alignment and structure
>pdb|1HBZ|A Chain A, Catalase From Micrococcus Lysodeikticu Length = 498 Back     alignment and structure
>pdb|1QWL|A Chain A, Structure Of Helicobacter Pylori Catalase Length = 505 Back     alignment and structure
>pdb|4AUL|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|4AUE|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 717 Back     alignment and structure
>pdb|4AUN|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|4AUM|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|1GWF|A Chain A, Compound Ii Structure Of Micrococcus Lysodeikticus Catalase Length = 503 Back     alignment and structure
>pdb|2A9E|A Chain A, Helicobacter Pylori Catalase Compound I Length = 505 Back     alignment and structure
>pdb|3EJ6|A Chain A, Neurospora Crassa Catalase-3 Crystal Structure Length = 688 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query205
1dgf_A497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 1e-51
1dgf_A497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 4e-24
1m7s_A484 Catalase; beta barrel, alpha helical domain, oxido 7e-49
1m7s_A484 Catalase; beta barrel, alpha helical domain, oxido 9e-23
2isa_A483 Catalase; peroxidase, heme, oxidoreductase, iron, 2e-48
2isa_A483 Catalase; peroxidase, heme, oxidoreductase, iron, 1e-21
1gwe_A503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 2e-47
1gwe_A503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 2e-21
1si8_A484 Catalase; N-terminal ARM, anti-parallel beta-barre 1e-46
1si8_A484 Catalase; N-terminal ARM, anti-parallel beta-barre 5e-20
1qwl_A505 KATA catalase; beta barrel, azide complex, oxyferr 2e-45
1qwl_A505 KATA catalase; beta barrel, azide complex, oxyferr 4e-19
2j2m_A491 Catalase; functional class, oxidoreductase; HET: H 2e-44
2j2m_A491 Catalase; functional class, oxidoreductase; HET: H 4e-18
2xq1_A509 Peroxisomal catalase; oxidoreductase, hydrogen per 4e-42
2xq1_A509 Peroxisomal catalase; oxidoreductase, hydrogen per 6e-17
1a4e_A488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 5e-42
1a4e_A488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 4e-17
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 7e-40
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 2e-15
3ttv_A 753 Catalase HPII; heme orientation, oxidoreductase; H 1e-37
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 2e-15
3ej6_A 688 Catalase-3; heme, hydrogen iron, metal-binding, ox 2e-37
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 5e-15
2iuf_A 688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 5e-29
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 2e-13
1u5u_A374 Allene oxide synthase-lipoxygenase protein; catala 2e-07
3e4w_A320 Putative uncharacterized protein; heme enzyme, cat 6e-07
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Length = 497 Back     alignment and structure
 Score =  172 bits (438), Expect = 1e-51
 Identities = 68/127 (53%), Positives = 84/127 (66%), Gaps = 1/127 (0%)

Query: 80  PFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAID-NQNGAPNYYPNS 138
             +QGRL +Y DTH HRLG N+  IPVNCPYR RVANYQRD PM +  NQ GAPNYYPNS
Sbjct: 345 KMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNS 404

Query: 139 FKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLK 198
           F  PE  P     +   +G+V+R+ T ++DN +Q R  + NVL++  R R+  NIA  LK
Sbjct: 405 FGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLK 464

Query: 199 LAAPFIQ 205
            A  FIQ
Sbjct: 465 DAQIFIQ 471
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Length = 497 Back     alignment and structure
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Length = 483 Back     alignment and structure
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Length = 483 Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Length = 503 Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Length = 503 Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Length = 505 Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Length = 505 Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Length = 491 Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Length = 491 Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Length = 509 Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Length = 509 Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Length = 488 Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Length = 488 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Length = 715 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Length = 715 Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Length = 753 Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Length = 753 Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Length = 688 Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Length = 688 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Length = 688 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Length = 688 Back     alignment and structure
>1u5u_A Allene oxide synthase-lipoxygenase protein; catalase, heme, eicosanoid, fusion PR lyase; HET: HEM; 2.00A {Plexaura homomalla} SCOP: e.5.1.2 Length = 374 Back     alignment and structure
>3e4w_A Putative uncharacterized protein; heme enzyme, catalase, peroxidase, oxidoreductase; HET: HEM; 1.80A {Mycobacterium avium subsp} PDB: 3e4y_A* Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query205
1m7s_A484 Catalase; beta barrel, alpha helical domain, oxido 99.98
1dgf_A497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 99.97
2isa_A483 Catalase; peroxidase, heme, oxidoreductase, iron, 99.97
1gwe_A503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 99.97
1si8_A484 Catalase; N-terminal ARM, anti-parallel beta-barre 99.97
2j2m_A491 Catalase; functional class, oxidoreductase; HET: H 99.97
1qwl_A505 KATA catalase; beta barrel, azide complex, oxyferr 99.97
3ttv_A 753 Catalase HPII; heme orientation, oxidoreductase; H 99.97
1a4e_A488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 99.97
2xq1_A509 Peroxisomal catalase; oxidoreductase, hydrogen per 99.96
2iuf_A 688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 99.96
3ej6_A 688 Catalase-3; heme, hydrogen iron, metal-binding, ox 99.96
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 99.95
1m7s_A484 Catalase; beta barrel, alpha helical domain, oxido 99.8
1dgf_A497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 99.8
1gwe_A503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 99.8
2isa_A483 Catalase; peroxidase, heme, oxidoreductase, iron, 99.79
1si8_A484 Catalase; N-terminal ARM, anti-parallel beta-barre 99.79
2j2m_A491 Catalase; functional class, oxidoreductase; HET: H 99.77
1qwl_A505 KATA catalase; beta barrel, azide complex, oxyferr 99.76
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 99.73
2xq1_A509 Peroxisomal catalase; oxidoreductase, hydrogen per 99.73
1a4e_A488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 99.72
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 99.7
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 99.64
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 99.63
1u5u_A374 Allene oxide synthase-lipoxygenase protein; catala 87.71
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Back     alignment and structure
Probab=99.98  E-value=3.9e-33  Score=254.15  Aligned_cols=127  Identities=24%  Similarity=0.364  Sum_probs=117.5

Q ss_pred             cchHHHHHHHHhhhhhhcccccccCCCcccCCCcccccCCcccCCCccccCCCCCCcccCCCCCCCCCCCCCCCCCceee
Q psy8829          77 LAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNAT  156 (205)
Q Consensus        77 ~~d~~Iq~R~~sy~d~~~~~LG~n~~~~pvN~P~~~~~~~~~rDG~m~~~n~~~~~nY~pn~~~~~~~~~~~~~~~~~~~  156 (205)
                      +.+++||.|+++|.+.+++|||.||.|||||||+|+ |+||||||+|++.|+++.|||+|||++++...+.+.++++.++
T Consensus       320 S~DplLq~R~fsY~ds~r~Rlg~N~~qlPvN~P~~~-~~~~~rdG~m~~~~~~~~~~y~pn~~~~~~~~~~~~~~~~~~~  398 (484)
T 1m7s_A          320 SEDRLLQGRVFSYADTQMYRLGANGLSLPVNQPKVA-VNNGNQDGALNTGHTTSGVNYEPSRLEPRPADDKARYSELPLS  398 (484)
T ss_dssp             CSCHHHHHHHHHHHHHHHHHTCTTGGGSGGGCCSSC-CCSSCCCCTTCCCCCCCSCCSSSCSSSCCCCCGGGCCCCCBCC
T ss_pred             CCChHHHHHHHHHHHHHHHhhcCCcccCCCCCCCCc-ccCccccCcccccCCCCCCCcCCCcCCCCCCCCCCCCCCeecc
Confidence            468999999999999999999999999999999997 9999999999998889999999999998777667777788889


Q ss_pred             cceeecccCCCCCccchHHHHHhcCCHHHHHHHHHHHHHHhccCCcccC
Q psy8829         157 GDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ  205 (205)
Q Consensus       157 g~~~~~~~~~~~df~Q~~~~~~~~~~~~~~~~l~~n~~~~l~~~~~~i~  205 (205)
                      |.+.++.+..+|||+|||+|| ++|++.||+|||+||+++|++|+++||
T Consensus       399 g~~~~~~~~~~d~~~q~~~~~-~~~~~~~~~~l~~n~~~~l~~~~~~i~  446 (484)
T 1m7s_A          399 GTTQQAKITREQNFKQAGDLY-RSYSAKEKTDLVQKFGESLADTLTESK  446 (484)
T ss_dssp             SBEECCCCSCCCCSHHHHHHH-HHSCHHHHHHHHHHHHHHHTTSCHHHH
T ss_pred             cceeeecCCCcchhhhHHHHH-HhCCHHHHHHHHHHHHHHHhccCHHHH
Confidence            999998877789999999999 799999999999999999999987664
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Back     alignment and structure
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Back     alignment and structure
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Back     alignment and structure
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>1u5u_A Allene oxide synthase-lipoxygenase protein; catalase, heme, eicosanoid, fusion PR lyase; HET: HEM; 2.00A {Plexaura homomalla} SCOP: e.5.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 205
d1dgfa_497 e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [Tax 3e-41
d1dgfa_497 e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [Tax 6e-21
d1m7sa_484 e.5.1.1 (A:) Catalase I {Pseudomonas syringae [Tax 5e-35
d1m7sa_484 e.5.1.1 (A:) Catalase I {Pseudomonas syringae [Tax 4e-18
d1si8a_474 e.5.1.1 (A:) Catalase I {Enterococcus faecalis [Ta 8e-35
d1si8a_474 e.5.1.1 (A:) Catalase I {Enterococcus faecalis [Ta 9e-16
d1gwea_498 e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus 9e-35
d1gwea_498 e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus 1e-16
d1e93a_476 e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 2e-34
d1e93a_476 e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 2e-15
d1qwla_491 e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxI 7e-33
d1qwla_491 e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxI 2e-14
d1a4ea_488 e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomy 6e-30
d1a4ea_488 e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomy 6e-12
d1p80a2571 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, 5e-28
d1p80a2571 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, 5e-12
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Heme-dependent catalase-like
superfamily: Heme-dependent catalase-like
family: Heme-dependent catalases
domain: Catalase I
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  143 bits (362), Expect = 3e-41
 Identities = 68/130 (52%), Positives = 84/130 (64%), Gaps = 1/130 (0%)

Query: 77  LAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAID-NQNGAPNYY 135
                +QGRL +Y DTH HRLG N+  IPVNCPYR RVANYQRD PM +  NQ GAPNYY
Sbjct: 342 SPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYY 401

Query: 136 PNSFKGPEPTPRGAWSTYNATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIAS 195
           PNSF  PE  P     +   +G+V+R+ T ++DN +Q R  + NVL++  R R+  NIA 
Sbjct: 402 PNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAG 461

Query: 196 VLKLAAPFIQ 205
            LK A  FIQ
Sbjct: 462 HLKDAQIFIQ 471
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Length = 484 Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Length = 484 Back     information, alignment and structure
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Length = 474 Back     information, alignment and structure
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Length = 474 Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Length = 498 Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Length = 498 Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Length = 476 Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Length = 476 Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Length = 491 Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Length = 491 Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 488 Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 488 Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Length = 571 Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Length = 571 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query205
d1dgfa_497 Catalase I {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1e93a_476 Catalase I {Proteus mirabilis [TaxId: 584]} 100.0
d1m7sa_484 Catalase I {Pseudomonas syringae [TaxId: 317]} 100.0
d1gwea_498 Catalase I {Micrococcus lysodeikticus [TaxId: 1270 100.0
d1si8a_474 Catalase I {Enterococcus faecalis [TaxId: 1351]} 100.0
d1qwla_491 Catalase I {Helicobacter pylori [TaxId: 210]} 100.0
d1a4ea_488 Catalase I {Baker's yeast (Saccharomyces cerevisia 99.97
d1p80a2571 Catalase II {Escherichia coli, HPII [TaxId: 562]} 99.97
d1dgfa_497 Catalase I {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1m7sa_484 Catalase I {Pseudomonas syringae [TaxId: 317]} 99.82
d1e93a_476 Catalase I {Proteus mirabilis [TaxId: 584]} 99.82
d1si8a_474 Catalase I {Enterococcus faecalis [TaxId: 1351]} 99.8
d1gwea_498 Catalase I {Micrococcus lysodeikticus [TaxId: 1270 99.8
d1qwla_491 Catalase I {Helicobacter pylori [TaxId: 210]} 99.75
d1a4ea_488 Catalase I {Baker's yeast (Saccharomyces cerevisia 99.69
d1p80a2571 Catalase II {Escherichia coli, HPII [TaxId: 562]} 99.68
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Heme-dependent catalase-like
superfamily: Heme-dependent catalase-like
family: Heme-dependent catalases
domain: Catalase I
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.6e-35  Score=269.45  Aligned_cols=130  Identities=53%  Similarity=0.905  Sum_probs=121.0

Q ss_pred             ccchHHHHHHHHhhhhhhcccccccCCCcccCCCcccccCCcccCCCccc-cCCCCCCcccCCCCCCCCCCCCCCCCCce
Q psy8829          76 KLAAPFIQGRLHSYIDTHIHRLGANFNQIPVNCPYRVRVANYQRDAPMAI-DNQNGAPNYYPNSFKGPEPTPRGAWSTYN  154 (205)
Q Consensus        76 ~~~d~~Iq~R~~sy~d~~~~~LG~n~~~~pvN~P~~~~~~~~~rDG~m~~-~n~~~~~nY~pn~~~~~~~~~~~~~~~~~  154 (205)
                      .+.|++||.|+|+|.+++++|||+||.|||||||++++++||||||+|++ +|.|+.|||+|||++++..++.+.+++..
T Consensus       341 ~S~Dp~Lq~R~~aY~dsqr~RlG~N~~qlPvN~P~~~~~~n~~rdG~m~~~~~~g~~~nY~pns~~~~~~~~~~~~~~~~  420 (497)
T d1dgfa_         341 ASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQ  420 (497)
T ss_dssp             ECSCHHHHHHHHHHHHHHHHHTCTTGGGSGGGSCTTSCCCSSCCCCTTCCSCTTTTCCCSSSCSSCCCBCCGGGCCCCEE
T ss_pred             CCCCchhhhhhhhhHHHHhhccCCChhhCCcCCCCcCCcCCcccCChhcccCCCCCCCCccCCCCCCcccCCCcCCCCce
Confidence            35789999999999999999999999999999998545999999999999 79999999999999999888888888899


Q ss_pred             eecceeecccCCCCCccchHHHHHhcCCHHHHHHHHHHHHHHhccCCcccC
Q psy8829         155 ATGDVKRYKTEDEDNFSQPRILWSNVLDDAARDRMTTNIASVLKLAAPFIQ  205 (205)
Q Consensus       155 ~~g~~~~~~~~~~~df~Q~~~~~~~~~~~~~~~~l~~n~~~~l~~~~~~i~  205 (205)
                      ++|.+.++.+..+|||+|||.||+++|+++||+|||+||+++|++|+++||
T Consensus       421 ~~g~~~~~~~~~~d~~~Q~~~~~~~~~~~~~~~~l~~n~~~~l~~~~~~i~  471 (497)
T d1dgfa_         421 YSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQ  471 (497)
T ss_dssp             CCSEEEECCCTTSCCSHHHHHHHHHTSCHHHHHHHHHHHHHHHTTSCHHHH
T ss_pred             eeeEEEecCCCCCCccccchHHHHHhCCHHHHHHHHHHHHHHhhCCCHHHH
Confidence            999999987778999999999998889999999999999999999987774
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Back     information, alignment and structure
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure