Diaphorina citri psyllid: psy8832

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----

MCLIVCVLIRHHVTDGPFQAYLTVIDWPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFYNITKASL

cccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccc

*CLIVCVLIRHHV***********************IKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVN************************ANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTI**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MCLIVCVLIRHHVTDGPFQAYLTVIDWPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFYNITKASL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
GATA-binding factor 3	Transcriptional activator which probably serves as a general switch factor for cell-specific development. It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of genes.	confident	P23825
GATA zinc finger domain-containing protein C1393.08		confident	O94720
Transcription factor GATA-4	Transcriptional activator. Binds to the upstream sequence of the H(+)/K(+)-ATPase beta gene and to a sequence containing the GATA motif. Acts as a transcriptional activator of ANF in cooperation with NKX2-5. Promotes cardiac myocyte enlargement.	confident	P46152

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0060575 [BP]	intestinal epithelial cell differentiation	probable	GO:0032502, GO:0044767, GO:0060429, GO:0048565, GO:0044707, GO:0048869, GO:0048856, GO:0044763, GO:0009888, GO:0055123, GO:0032501, GO:0008150, GO:0030855, GO:0030154, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0002065
GO:0006366 [BP]	transcription from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0003705 [MF]	RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity	probable	GO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001077 [MF]	RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription	probable	GO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0045766 [BP]	positive regulation of angiogenesis	probable	GO:0022603, GO:0050793, GO:0051094, GO:0045765, GO:0008150, GO:1901342, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0071773 [BP]	cellular response to BMP stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0071363, GO:0050896, GO:0009987, GO:0044763, GO:0070848, GO:0071310, GO:0008150, GO:0044699, GO:0070887, GO:0042221, GO:0010033, GO:0071772
GO:0007596 [BP]	blood coagulation	probable	GO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0042035 [BP]	regulation of cytokine biosynthetic process	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051246, GO:0050794, GO:0001817, GO:0010556, GO:0065007, GO:0051239, GO:0008150, GO:0050789
GO:0006909 [BP]	phagocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0048839 [BP]	inner ear development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0007275, GO:0044699
GO:0035270 [BP]	endocrine system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0000983 [MF]	RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity	probable	GO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0048562 [BP]	embryonic organ morphogenesis	probable	GO:0048598, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0070742 [MF]	C2H2 zinc finger domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0032703 [BP]	negative regulation of interleukin-2 production	probable	GO:0051241, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0032663, GO:0050789, GO:0001818
GO:0072676 [BP]	lymphocyte migration	probable	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0002376, GO:0050900, GO:0051674, GO:0008150, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0000979 [MF]	RNA polymerase II core promoter sequence-specific DNA binding	probable	GO:0044212, GO:0003676, GO:0043565, GO:0001067, GO:0000975, GO:0001012, GO:0000976, GO:0000977, GO:0001047, GO:0001046, GO:0003674, GO:0097159, GO:0003677, GO:1901363, GO:0005488
GO:0007493 [BP]	endodermal cell fate determination	probable	GO:0048598, GO:0007492, GO:0007369, GO:0030154, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0001706, GO:0001704, GO:0048869, GO:0001709, GO:0048646, GO:0032502, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0035987, GO:0001711, GO:0045165, GO:0044707, GO:0048856, GO:0060795, GO:0008150
GO:0045746 [BP]	negative regulation of Notch signaling pathway	probable	GO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0097067 [BP]	cellular response to thyroid hormone stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0097066, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0032870, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0001889 [BP]	liver development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0061008, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0060975 [BP]	cardioblast migration to the midline involved in heart field formation	probable	GO:0048856, GO:0060029, GO:0060026, GO:0006928, GO:0072359, GO:0072358, GO:0060974, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0003260, GO:0060914, GO:0048513, GO:0048729, GO:0016477, GO:0048645, GO:0048646, GO:0032502, GO:0009887, GO:0009987, GO:0032501, GO:0060429, GO:0060973, GO:0009888, GO:0003007, GO:0008150, GO:0051179, GO:0040011, GO:0007507, GO:0044707, GO:0048870, GO:0003318, GO:0044763, GO:0051674, GO:0044767, GO:0048731
GO:0031100 [BP]	organ regeneration	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0031099, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0060231 [BP]	mesenchymal to epithelial transition	probable	GO:0032502, GO:0000904, GO:0000902, GO:0048869, GO:0071840, GO:0060429, GO:0048468, GO:0009888, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0044699, GO:0003382, GO:0030855, GO:0030154, GO:0008150, GO:0009987, GO:0009653, GO:0002064, GO:0048856
GO:0032911 [BP]	negative regulation of transforming growth factor beta1 production	probable	GO:0032908, GO:0051241, GO:0050789, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0071635, GO:0071634, GO:0001818
GO:0032912 [BP]	negative regulation of transforming growth factor beta2 production	probable	GO:0032909, GO:0051241, GO:0050789, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0071635, GO:0071634, GO:0001818
GO:2000114 [BP]	regulation of establishment of cell polarity	probable	GO:0008150, GO:0032878, GO:0065007, GO:0050789, GO:0050794
GO:0071353 [BP]	cellular response to interleukin-4	probable	GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0070670, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0010259 [BP]	multicellular organismal aging	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045650 [BP]	negative regulation of macrophage differentiation	probable	GO:0002761, GO:0051093, GO:0002762, GO:0045649, GO:0045596, GO:0050793, GO:1902105, GO:0050794, GO:0050789, GO:1902106, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0051239, GO:0048519, GO:2000026, GO:0045595, GO:0045637, GO:0048523
GO:0032526 [BP]	response to retinoic acid	probable	GO:1901700, GO:0033993, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0070888 [MF]	E-box binding	probable	GO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0060374 [BP]	mast cell differentiation	probable	GO:0032502, GO:0002376, GO:0048856, GO:0044707, GO:0008150, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0048731, GO:0002573, GO:0044767, GO:0048513, GO:0044763, GO:0044699, GO:0030099, GO:0030097, GO:0048534, GO:0007275, GO:0002521, GO:0002520
GO:0060070 [BP]	canonical Wnt receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0046983 [MF]	protein dimerization activity	probable	GO:0003674, GO:0005488, GO:0005515
GO:0001947 [BP]	heart looping	probable	GO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009799, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007368, GO:0048513, GO:0048729, GO:0060562, GO:0061371, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0007507, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0007389, GO:0008150, GO:0035295, GO:0003143, GO:0044707, GO:0048856, GO:0044767, GO:0009855, GO:0048731
GO:0050766 [BP]	positive regulation of phagocytosis	probable	GO:0051130, GO:0050764, GO:0032879, GO:0051050, GO:0051049, GO:0060627, GO:0065007, GO:0048518, GO:0008150, GO:0045807, GO:0051128, GO:0030100, GO:0050789, GO:0050794, GO:0048522
GO:0071372 [BP]	cellular response to follicle-stimulating hormone stimulus	probable	GO:0071495, GO:0071371, GO:0051716, GO:0032354, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0009719, GO:0008150, GO:0032870, GO:0044763, GO:0070887, GO:0034698, GO:0042221, GO:0010033, GO:0044699
GO:2000664 [BP]	positive regulation of interleukin-5 secretion	probable	GO:0051046, GO:0051047, GO:0051049, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0050708, GO:0060341, GO:0050707, GO:2000662, GO:0065007, GO:0048518, GO:0032674, GO:0070201, GO:0051050, GO:0050794, GO:0008150, GO:0051239, GO:0032879, GO:0050715, GO:0050714, GO:0001817, GO:0048522
GO:0071733 [BP]	transcriptional activation by promoter-enhancer looping	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0090202, GO:0010628, GO:0050789, GO:0044699, GO:0080090, GO:0010604, GO:0006325, GO:0051171, GO:0009891, GO:2000112, GO:0016043, GO:0019219, GO:0010556, GO:0065007, GO:0071840, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0045893, GO:2001141, GO:0006996, GO:0051276, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0008150, GO:0048522
GO:0048821 [BP]	erythrocyte development	probable	GO:0030154, GO:0048468, GO:0042592, GO:0061515, GO:0007275, GO:0044699, GO:0048869, GO:0002262, GO:0048513, GO:0065007, GO:0048534, GO:0065008, GO:0032502, GO:0034101, GO:0032501, GO:0030218, GO:0009987, GO:0048731, GO:0044767, GO:0044763, GO:0030097, GO:0002520, GO:0048872, GO:0044707, GO:0048856, GO:0002376, GO:0030099, GO:0008150
GO:0051270 [BP]	regulation of cellular component movement	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789, GO:0050794
GO:0045064 [BP]	T-helper 2 cell differentiation	probable	GO:0030154, GO:0046632, GO:0046631, GO:0045321, GO:0007275, GO:0044699, GO:0042093, GO:0042092, GO:0002286, GO:0002287, GO:0002285, GO:0048869, GO:0002263, GO:0002366, GO:0048534, GO:0043367, GO:0032502, GO:0032501, GO:0030217, GO:0009987, GO:0048731, GO:0044767, GO:0001775, GO:0046649, GO:0008150, GO:0042110, GO:0006955, GO:0002521, GO:0002520, GO:0048513, GO:0002293, GO:0002292, GO:0002294, GO:0044707, GO:0050896, GO:0048856, GO:0044763, GO:0002376, GO:0030098, GO:0002252, GO:0030097, GO:0035710
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0071158 [BP]	positive regulation of cell cycle arrest	probable	GO:0090068, GO:0051726, GO:0010564, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0071156, GO:0048522
GO:0017053 [CC]	transcriptional repressor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043627 [BP]	response to estrogen stimulus	probable	GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0007267 [BP]	cell-cell signaling	probable	GO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0060395 [BP]	SMAD protein signal transduction	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699, GO:0007178
GO:0019901 [MF]	protein kinase binding	probable	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0021514 [BP]	ventral spinal cord interneuron differentiation	probable	GO:0032502, GO:0032501, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0021515, GO:0048869, GO:0021517, GO:0030154, GO:0021510, GO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0044707, GO:0048731, GO:0022008, GO:0007275, GO:0021953, GO:0007417
GO:0030509 [BP]	BMP signaling pathway	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0007178, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0051569 [BP]	regulation of histone H3-K4 methylation	probable	GO:0033044, GO:0032268, GO:0080090, GO:0019222, GO:0033043, GO:0060255, GO:0051246, GO:0031056, GO:0031323, GO:0051128, GO:0008150, GO:0031060, GO:0031399, GO:0065007, GO:0050794, GO:0050789
GO:0060947 [BP]	cardiac vascular smooth muscle cell differentiation	probable	GO:0030154, GO:0072359, GO:0072358, GO:0051145, GO:0060976, GO:0061061, GO:0007275, GO:0044699, GO:0048869, GO:0001568, GO:0001944, GO:0008150, GO:0048513, GO:0032502, GO:0032501, GO:0009987, GO:0035051, GO:0044767, GO:0044763, GO:0007507, GO:0035886, GO:0044707, GO:0048856, GO:0048731, GO:0042692
GO:0010724 [BP]	regulation of definitive erythrocyte differentiation	probable	GO:0050793, GO:0045646, GO:0045637, GO:0008150, GO:0045595, GO:0065007, GO:2000026, GO:0051239, GO:0002682, GO:0032844, GO:0050789, GO:0050794
GO:0003002 [BP]	regionalization	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0045654 [BP]	positive regulation of megakaryocyte differentiation	probable	GO:0051094, GO:0050793, GO:0045652, GO:0065007, GO:0050794, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0045637, GO:0048522
GO:0023019 [BP]	signal transduction involved in regulation of gene expression	probable	GO:0044700, GO:0051716, GO:0019222, GO:0008150, GO:0060255, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0010468, GO:0044699
GO:0003179 [BP]	heart valve morphogenesis	probable	GO:0032502, GO:0007507, GO:0003170, GO:0044707, GO:0072358, GO:0032501, GO:0048856, GO:0044767, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0044710 [BP]	single-organism metabolic process	probable	GO:0008150, GO:0008152
GO:0008301 [MF]	DNA binding, bending	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0048732 [BP]	gland development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0061085 [BP]	regulation of histone H3-K27 methylation	probable	GO:0033044, GO:0032268, GO:0080090, GO:0019222, GO:0033043, GO:0060255, GO:0051246, GO:0031056, GO:0031323, GO:0051128, GO:0008150, GO:0031060, GO:0031399, GO:0065007, GO:0050794, GO:0050789
GO:0060045 [BP]	positive regulation of cardiac muscle cell proliferation	probable	GO:0042127, GO:0048638, GO:0048634, GO:0060043, GO:0050789, GO:0040008, GO:0046620, GO:0065007, GO:0048518, GO:0008284, GO:0016202, GO:0060420, GO:0050793, GO:0055024, GO:1901861, GO:0055021, GO:0008150, GO:0051239, GO:0050794, GO:0051094, GO:2000026, GO:0051240, GO:0048522
GO:0045582 [BP]	positive regulation of T cell differentiation	probable	GO:0050865, GO:0050867, GO:0050863, GO:0045580, GO:0050789, GO:0051249, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0050793, GO:0050870, GO:0050794, GO:0045597, GO:0045621, GO:0045595, GO:0008150, GO:0051239, GO:0051094, GO:0051251, GO:1902107, GO:0002694, GO:1902105, GO:0002696, GO:2000026, GO:0045619, GO:0048522
GO:0030324 [BP]	lung development	probable	GO:0060541, GO:0032502, GO:0030323, GO:0044707, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0007275, GO:0044699
GO:2000178 [BP]	negative regulation of neural precursor cell proliferation	probable	GO:0042127, GO:0008285, GO:0050794, GO:0008150, GO:2000177, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0072001 [BP]	renal system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0001655, GO:0048731, GO:0007275, GO:0044699
GO:0010575 [BP]	positive regulation vascular endothelial growth factor production	probable	GO:0051240, GO:0010574, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789, GO:0001819
GO:2000678 [BP]	negative regulation of transcription regulatory region DNA binding	probable	GO:0051098, GO:0051101, GO:0051100, GO:2000677, GO:0065007, GO:0043392, GO:0044092, GO:0008150, GO:0065009
GO:0050852 [BP]	T cell receptor signaling pathway	probable	GO:0048584, GO:0048583, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0002764, GO:0002768, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0050851, GO:0002757, GO:0009987, GO:0050794, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002429, GO:0050896, GO:0050778, GO:0002376, GO:0002253, GO:0044763
GO:0003148 [BP]	outflow tract septum morphogenesis	probable	GO:0003151, GO:0044767, GO:0009887, GO:0003206, GO:0003279, GO:0044707, GO:0007507, GO:0048513, GO:0032501, GO:0003205, GO:0003007, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0060411, GO:0009653, GO:0032502, GO:0007275, GO:0044699, GO:0048856
GO:0035065 [BP]	regulation of histone acetylation	probable	GO:0033044, GO:0032268, GO:0080090, GO:0019222, GO:0033043, GO:0060255, GO:0051246, GO:0031056, GO:0031323, GO:0051128, GO:0065007, GO:1901983, GO:2000756, GO:0031399, GO:0008150, GO:0050794, GO:0050789
GO:0008584 [BP]	male gonad development	probable	GO:0032502, GO:0022414, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0046546, GO:0061458, GO:0048856, GO:0008406, GO:0045137, GO:0007275, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0046661, GO:0044699
GO:0001076 [MF]	RNA polymerase II transcription factor binding transcription factor activity	probable	GO:0003674, GO:0000989, GO:0000988
GO:0001078 [MF]	RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription	probable	GO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0003713 [MF]	transcription coactivator activity	probable	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0009612 [BP]	response to mechanical stimulus	probable	GO:0009628, GO:0050896, GO:0008150, GO:0009605
GO:0031016 [BP]	pancreas development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031965 [CC]	nuclear membrane	probable	GO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030513 [BP]	positive regulation of BMP signaling pathway	probable	GO:0090092, GO:0010646, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0050789, GO:0030510
GO:0003215 [BP]	cardiac right ventricle morphogenesis	probable	GO:0003205, GO:0044767, GO:0009887, GO:0003206, GO:0044707, GO:0007507, GO:0048513, GO:0032501, GO:0048856, GO:0003208, GO:0003007, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0003231, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0071222 [BP]	cellular response to lipopolysaccharide	probable	GO:0070887, GO:0032496, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0071219, GO:0071216, GO:0009987, GO:0071396, GO:0008150, GO:0042221, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0044763
GO:0005667 [CC]	transcription factor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0060413 [BP]	atrial septum morphogenesis	probable	GO:0003283, GO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0003205, GO:0003206, GO:0003209, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0003007, GO:0008150, GO:0003230, GO:0007507, GO:0003279, GO:0044707, GO:0048856, GO:0044767, GO:0048731, GO:0060411
GO:0045599 [BP]	negative regulation of fat cell differentiation	probable	GO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523, GO:0045598
GO:0000978 [MF]	RNA polymerase II core promoter proximal region sequence-specific DNA binding	probable	GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0045648 [BP]	positive regulation of erythrocyte differentiation	probable	GO:0051094, GO:0050793, GO:0045646, GO:0065007, GO:0032844, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0050794, GO:0045637, GO:0048522
GO:0035854 [BP]	eosinophil fate commitment	probable	GO:0030851, GO:0030154, GO:0048468, GO:0030222, GO:0007275, GO:0044699, GO:0048869, GO:0002573, GO:0008150, GO:0048513, GO:0048534, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0030097, GO:0002521, GO:0002520, GO:0045165, GO:0044707, GO:0048856, GO:0002376, GO:0030099, GO:0048731
GO:0071456 [BP]	cellular response to hypoxia	probable	GO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0000980 [MF]	RNA polymerase II distal enhancer sequence-specific DNA binding	probable	GO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0033600 [BP]	negative regulation of mammary gland epithelial cell proliferation	probable	GO:0042127, GO:0008285, GO:0050678, GO:0050793, GO:0050680, GO:0033599, GO:0008150, GO:0065007, GO:2000026, GO:0051239, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0001701 [BP]	in utero embryonic development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0003281 [BP]	ventricular septum development	probable	GO:0003205, GO:0032502, GO:0032501, GO:0003279, GO:0044707, GO:0007507, GO:0048513, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0003231, GO:0007275, GO:0044699
GO:0001103 [MF]	RNA polymerase II repressing transcription factor binding	probable	GO:0001085, GO:0008134, GO:0003674, GO:0005488, GO:0005515, GO:0070491
GO:0035162 [BP]	embryonic hemopoiesis	probable	GO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0003690 [MF]	double-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0061049 [BP]	cell growth involved in cardiac muscle cell development	probable	GO:0055017, GO:0072359, GO:0055013, GO:0048589, GO:0048588, GO:0030154, GO:0048468, GO:0014706, GO:0072358, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0016049, GO:0055006, GO:0035265, GO:0048869, GO:0003300, GO:0003301, GO:0048513, GO:0003008, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0003298, GO:0055007, GO:0009987, GO:0035051, GO:0009888, GO:0044767, GO:0044763, GO:0060419, GO:0048731, GO:0040007, GO:0007507, GO:0044707, GO:0048856, GO:0003012, GO:0048738, GO:0014896, GO:0014897, GO:0060537, GO:0008150, GO:0042692
GO:0097028 [BP]	dendritic cell differentiation	probable	GO:0032502, GO:0002376, GO:0009987, GO:0044707, GO:0048856, GO:0008150, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0044699, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0002521, GO:0002520
GO:0070410 [MF]	co-SMAD binding	probable	GO:0046332, GO:0003674, GO:0005488, GO:0005515
GO:0048666 [BP]	neuron development	probable	GO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HC9, chain A
Confidence level:very confident
Coverage over the Query: 38-141
View the alignment between query and template
View the model in PyMOL