Psyllid ID: psy8832

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MCLIVCVLIRHHVTDGPFQAYLTVIDWPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFYNITKASL
cccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccc
ccccccccccccccccccccccccccccccccccccccEEEcccccccccEEcccccccccccccHHHHcccccccccccccccccccccccccccEEEcccccccEEEEcccccccccccccEEEEccccccccccccccccc
MCLIVCVLIrhhvtdgpfqaYLTVIDwpqnmmlnmDIKECVNcaanstplwrrdgtghhlcnacglynringvnrppvrtnQKKALQQtgnkrsgvscancsttcttlwrrnnngepvcnacgLYFKLHNVFTILFYNITKASL
MCLIVCVLIrhhvtdgpfqAYLTVIDWPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALqqtgnkrsgvscaNCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFYNITKASL
MCLIVCVLIRHHVTDGPFQAYLTVIDWPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFYNITKASL
*CLIVCVLIRHHVTDGPFQAYLTVIDWPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVN*********************VSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFYNIT****
*C*I****************************************ANSTPL********************************KKALQQTGN*************************PVCNACGLYFKLHNVFT***********
MCLIVCVLIRHHVTDGPFQAYLTVIDWPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRT******************ANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFYNITKASL
*CLIVCVLIRHHV***********************IKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTN***********RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTI**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLIVCVLIRHHVTDGPFQAYLTVIDWPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFYNITKASL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
P91623 486 GATA-binding factor C OS= no N/A 0.652 0.193 0.697 2e-37
Q0Q0E4 442 Transcription factor GATA yes N/A 0.625 0.203 0.659 4e-36
P43694 442 Transcription factor GATA yes N/A 0.625 0.203 0.659 4e-36
P46152 440 Transcription factor GATA yes N/A 0.625 0.204 0.659 5e-36
Q91428438 Transcription factor GATA yes N/A 0.625 0.205 0.659 7e-36
P23772443 Trans-acting T-cell-speci no N/A 0.625 0.203 0.659 1e-35
Q08DV0443 Trans-acting T-cell-speci no N/A 0.625 0.203 0.659 1e-35
P23771443 Trans-acting T-cell-speci no N/A 0.625 0.203 0.659 1e-35
Q08369 440 Transcription factor GATA yes N/A 0.625 0.204 0.659 2e-35
P23773435 GATA-binding factor 3 OS= N/A N/A 0.625 0.206 0.659 2e-35
>sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 Back     alignment and function desciption
 Score =  154 bits (389), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/96 (69%), Positives = 79/96 (82%), Gaps = 2/96 (2%)

Query: 38  KECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQ--QTGNKRSG 95
           +ECVNC A STPLWRRDGTGH+LCNACGLY ++NG NRP ++  ++  LQ  Q+  KR+G
Sbjct: 259 RECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAG 318

Query: 96  VSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNV 131
            SCANC TT TTLWRRN +GEPVCNACGLY+KLHNV
Sbjct: 319 TSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNV 354
Transcription factor that is vital to the development of multiple organ systems. Binds to the core consensus sequence 5'-WGATAR-3'.
Drosophila melanogaster (taxid: 7227)
>sp|Q0Q0E4|GATA4_CANFA Transcription factor GATA-4 OS=Canis familiaris GN=GATA4 PE=2 SV=1 Back     alignment and function description
>sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 Back     alignment and function description
>sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 Back     alignment and function description
>sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 Back     alignment and function description
>sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 Back     alignment and function description
>sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 Back     alignment and function description
>sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 Back     alignment and function description
>sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=3 Back     alignment and function description
>sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
328721860 637 PREDICTED: hypothetical protein LOC10016 0.729 0.164 0.866 8e-50
357609511 633 GATA transcription factor GATAc [Danaus 0.75 0.170 0.642 2e-44
332016552 704 GATA-binding factor A [Acromyrmex echina 0.694 0.142 0.712 3e-40
307186220 713 Transcription factor GATA-4 [Camponotus 0.631 0.127 0.711 1e-39
307198089 728 GATA-binding factor A [Harpegnathos salt 0.812 0.160 0.593 3e-38
322782909 726 hypothetical protein SINV_01972 [Solenop 0.652 0.129 0.729 2e-37
285157832 730 GATA456a [Themiste lageniformis] 0.708 0.139 0.632 2e-36
157169239 750 GATA-binding transcription factor B1 [Ca 0.652 0.125 0.640 3e-36
195037647 696 GH19248 [Drosophila grimshawi] gi|193894 0.652 0.135 0.697 3e-36
221378310 699 grain, isoform B [Drosophila melanogaste 0.652 0.134 0.697 4e-36
>gi|328721860|ref|XP_001943307.2| PREDICTED: hypothetical protein LOC100166174 isoform 1 [Acyrthosiphon pisum] gi|328721862|ref|XP_003247419.1| PREDICTED: hypothetical protein LOC100166174 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 91/105 (86%), Positives = 97/105 (92%)

Query: 27  WPQNMMLNMDIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKAL 86
           + QN +LN+D+KECVNCAAN TPLWRRDGTGHHLCNACGLYNRINGVNRPPVR+ QKK  
Sbjct: 404 YDQNGILNVDMKECVNCAANVTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRSAQKKTT 463

Query: 87  QQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNV 131
           QQTGNKRSGV+CANCST  TTLWRRNNNGEPVCNACGLYFKLHNV
Sbjct: 464 QQTGNKRSGVACANCSTNTTTLWRRNNNGEPVCNACGLYFKLHNV 508

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357609511|gb|EHJ66491.1| GATA transcription factor GATAc [Danaus plexippus] Back     alignment and taxonomy information
>gi|332016552|gb|EGI57433.1| GATA-binding factor A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307186220|gb|EFN71904.1| Transcription factor GATA-4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307198089|gb|EFN79142.1| GATA-binding factor A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322782909|gb|EFZ10627.1| hypothetical protein SINV_01972 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|285157832|gb|ADC35039.1| GATA456a [Themiste lageniformis] Back     alignment and taxonomy information
>gi|157169239|gb|ABV25954.1| GATA-binding transcription factor B1 [Capitella teleta] Back     alignment and taxonomy information
>gi|195037647|ref|XP_001990272.1| GH19248 [Drosophila grimshawi] gi|193894468|gb|EDV93334.1| GH19248 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|221378310|ref|NP_001138026.1| grain, isoform B [Drosophila melanogaster] gi|220903030|gb|ACL83485.1| grain, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
ZFIN|ZDB-GENE-990415-82438 gata3 "GATA-binding protein 3" 0.625 0.205 0.680 1.7e-36
UNIPROTKB|G1K308444 GATA3 "GATA-binding factor 3" 0.625 0.202 0.680 1.7e-36
UNIPROTKB|P23825444 GATA3 "GATA-binding factor 3" 0.625 0.202 0.680 1.7e-36
UNIPROTKB|E2RPT1444 GATA3 "Uncharacterized protein 0.625 0.202 0.680 2.2e-36
UNIPROTKB|D2HDE5412 PANDA_008702 "Putative unchara 0.625 0.218 0.680 2.2e-36
UNIPROTKB|P23771443 GATA3 "Trans-acting T-cell-spe 0.625 0.203 0.680 2.2e-36
MGI|MGI:95663443 Gata3 "GATA binding protein 3" 0.625 0.203 0.680 2.2e-36
RGD|621250444 Gata3 "GATA binding protein 3" 0.625 0.202 0.680 2.2e-36
UNIPROTKB|Q08DV0443 GATA3 "Trans-acting T-cell-spe 0.625 0.203 0.680 2.2e-36
FB|FBgn0001138 486 grn "grain" [Drosophila melano 0.652 0.193 0.697 3.5e-36
ZFIN|ZDB-GENE-990415-82 gata3 "GATA-binding protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 375 (137.1 bits), Expect = 1.7e-36, Sum P(2) = 1.7e-36
 Identities = 64/94 (68%), Positives = 77/94 (81%)

Query:    38 KECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQQTGNKRSGVS 97
             +ECVNC A STPLWRRDGTGH+LCNACGLY+++NG NRP ++   K+ L     +R+G S
Sbjct:   254 RECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKP--KRRLSAA--RRAGTS 309

Query:    98 CANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNV 131
             CANC TT TTLWRRN NG+PVCNACGLY+KLHN+
Sbjct:   310 CANCQTTTTTLWRRNANGDPVCNACGLYYKLHNI 343
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0021514 "ventral spinal cord interneuron differentiation" evidence=IMP
GO:0060788 "ectodermal placode formation" evidence=IGI
GO:0005634 "nucleus" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
UNIPROTKB|G1K308 GATA3 "GATA-binding factor 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P23825 GATA3 "GATA-binding factor 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPT1 GATA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D2HDE5 PANDA_008702 "Putative uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms
UNIPROTKB|P23771 GATA3 "Trans-acting T-cell-specific transcription factor GATA-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95663 Gata3 "GATA binding protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621250 Gata3 "GATA binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DV0 GATA3 "Trans-acting T-cell-specific transcription factor GATA-3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0001138 grn "grain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46152GATA4_RATNo assigned EC number0.65950.6250.2045yesN/A
Q08369GATA4_MOUSENo assigned EC number0.65950.6250.2045yesN/A
Q91428GATA3_DANRENo assigned EC number0.65950.6250.2054yesN/A
O94720YCF8_SCHPONo assigned EC number0.50530.57630.1490yesN/A
P43694GATA4_HUMANNo assigned EC number0.65950.6250.2036yesN/A
P23825GATA3_CHICKNo assigned EC number0.65950.6250.2027yesN/A
Q0Q0E4GATA4_CANFANo assigned EC number0.65950.6250.2036yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
cd0020254 cd00202, ZnF_GATA, Zinc finger DNA binding domain; 4e-12
smart0040152 smart00401, ZnF_GATA, zinc finger binding to DNA c 6e-12
cd0020254 cd00202, ZnF_GATA, Zinc finger DNA binding domain; 7e-11
pfam0032036 pfam00320, GATA, GATA zinc finger 1e-10
COG5641 498 COG5641, GAT1, GATA Zn-finger-containing transcrip 5e-10
pfam0032036 pfam00320, GATA, GATA zinc finger 8e-10
smart0040152 smart00401, ZnF_GATA, zinc finger binding to DNA c 1e-09
COG5641 498 COG5641, GAT1, GATA Zn-finger-containing transcrip 1e-07
COG5641 498 COG5641, GAT1, GATA Zn-finger-containing transcrip 1e-04
>gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information 
 Score = 57.0 bits (138), Expect = 4e-12
 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 39 ECVNCAANSTPLWRRDG-TGHHLCNACGLYNRINGVNRP 76
           C NC   +TPLWRR    G  LCNACGLY + +GV RP
Sbjct: 1  ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRP 39

Length = 54
>gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
>gnl|CDD|109380 pfam00320, GATA, GATA zinc finger Back     alignment and domain information
>gnl|CDD|227928 COG5641, GAT1, GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|109380 pfam00320, GATA, GATA zinc finger Back     alignment and domain information
>gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>gnl|CDD|227928 COG5641, GAT1, GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|227928 COG5641, GAT1, GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 99.66
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 99.63
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 99.51
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 99.51
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 99.5
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 99.41
KOG1601|consensus340 99.24
COG5641 498 GAT1 GATA Zn-finger-containing transcription facto 99.16
COG5641 498 GAT1 GATA Zn-finger-containing transcription facto 98.82
KOG1601|consensus340 98.35
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 89.9
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 88.52
KOG3554|consensus 693 87.72
PRK14559 645 putative protein serine/threonine phosphatase; Pro 87.23
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 86.62
PF1277350 DZR: Double zinc ribbon 81.79
KOG3554|consensus 693 81.15
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 81.14
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information 
Probab=99.66  E-value=5e-17  Score=102.84  Aligned_cols=43  Identities=51%  Similarity=1.018  Sum_probs=40.5

Q ss_pred             ccccCCcccccccccCCCC-CcccchhHHHHHhhCCCCcccccc
Q psy8832          97 SCANCSTTCTTLWRRNNNG-EPVCNACGLYFKLHNVFTILFYNI  139 (144)
Q Consensus        97 ~C~nC~t~~t~~WR~~~~g-~~lCnaCglyy~~~~~~Rp~~l~~  139 (144)
                      +|+||++++||+||+++++ ..|||||||||++++..||++++.
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~   44 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRK   44 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCc
Confidence            5999999999999999954 899999999999999999999987

>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1601|consensus Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>KOG1601|consensus Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>KOG3554|consensus Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>KOG3554|consensus Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
4hc7_A115 Crystal Structure Of The Full Dna Binding Domain Of 4e-33
3vd6_C119 Both Zn Fingers Of Gata1 Bound To Palindromic Dna R 2e-26
3dfv_D63 Adjacent Gata Dna Binding Length = 63 3e-14
1y0j_A46 Zinc Fingers As Protein Recognition Motifs: Structu 9e-14
1y0j_A46 Zinc Fingers As Protein Recognition Motifs: Structu 4e-05
1gnf_A46 Solution Structure Of The N-Terminal Zinc Finger Of 3e-13
1gnf_A46 Solution Structure Of The N-Terminal Zinc Finger Of 4e-05
2l6y_A39 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 1e-11
2l6y_A39 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 5e-05
3gat_A66 Solution Nmr Structure Of The C-Terminal Domain Of 2e-11
1gat_A60 Solution Structure Of The Specific Dna Complex Of T 3e-11
4gat_A66 Solution Nmr Structure Of The Wild Type Dna Binding 1e-08
7gat_A66 Solution Nmr Structure Of The L22v Mutant Dna Bindi 3e-08
2vus_I43 Crystal Structure Of Unliganded Nmra-Area Zinc Fing 6e-08
>pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 Back     alignment and structure 
Iteration: 1

 Score =  136 bits (342), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 62/94 (65%), Positives = 77/94 (81%), Gaps = 4/94 (4%)
Query: 38  KECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQQTGNKRSGVS 97
           +ECVNC A STPLWRRDGTGH+LCNACGLY+++NG NRP ++  ++ +      +R+G S
Sbjct: 6   RECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA----RRAGTS 61
Query: 98  CANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNV 131
           CANC TT TTLWRRN NG+PVCNACGLY+KLHN+
Sbjct: 62  CANCQTTTTTLWRRNANGDPVCNACGLYYKLHNI 95
>pdb|3VD6|C Chain C, Both Zn Fingers Of Gata1 Bound To Palindromic Dna Recognition Site, P21 Crystal Form Length = 119 Back     alignment and structure
>pdb|3DFV|D Chain D, Adjacent Gata Dna Binding Length = 63 Back     alignment and structure
>pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 Back     alignment and structure
>pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 Back     alignment and structure
>pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 Back     alignment and structure
>pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 Back     alignment and structure
>pdb|2L6Y|A Chain A, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 39 Back     alignment and structure
>pdb|2L6Y|A Chain A, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 39 Back     alignment and structure
>pdb|3GAT|A Chain A, Solution Nmr Structure Of The C-Terminal Domain Of Chicken Gata-1 Bound To Dna, 34 Structures Length = 66 Back     alignment and structure
>pdb|1GAT|A Chain A, Solution Structure Of The Specific Dna Complex Of The Zinc Containing Dna Binding Domain Of The Erythroid Transcription Factor Gata-1 By Multidimensional Nmr Length = 60 Back     alignment and structure
>pdb|4GAT|A Chain A, Solution Nmr Structure Of The Wild Type Dna Binding Domain Of Area Complexed To A 13bp Dna Containing A Cgata Site, Regularized Mean Structure Length = 66 Back     alignment and structure
>pdb|7GAT|A Chain A, Solution Nmr Structure Of The L22v Mutant Dna Binding Domain Of Area Complexed To A 13 Bp Dna Containing A Tgata Site, 34 Structures Length = 66 Back     alignment and structure
>pdb|2VUS|I Chain I, Crystal Structure Of Unliganded Nmra-Area Zinc Finger Complex Length = 43 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 1e-16
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 8e-15
3dfx_A63 Trans-acting T-cell-specific transcription factor 5e-15
3dfx_A63 Trans-acting T-cell-specific transcription factor 3e-12
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 5e-15
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 5e-12
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 2e-14
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 8e-13
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 8e-14
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 1e-12
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 8e-06
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 Back     alignment and structure
 Score = 67.8 bits (166), Expect = 1e-16
 Identities = 30/42 (71%), Positives = 37/42 (88%)

Query: 38 KECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVR 79
          +ECVNC A +TPLWRRD TGH+LCNACGLY+++NG NRP +R
Sbjct: 5  RECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIR 46
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
4hc9_A115 Trans-acting T-cell-specific transcription factor; 100.0
3dfx_A63 Trans-acting T-cell-specific transcription factor 99.83
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 99.82
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 99.79
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 99.78
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 99.74
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 99.73
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 99.72
3dfx_A63 Trans-acting T-cell-specific transcription factor 99.68
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 99.67
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 99.6
4hc9_A115 Trans-acting T-cell-specific transcription factor; 99.57
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 90.4
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 84.51
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 84.44
1k81_A36 EIF-2-beta, probable translation initiation factor 84.08
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 81.19
1k81_A36 EIF-2-beta, probable translation initiation factor 80.86
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
Probab=100.00  E-value=1.2e-38  Score=228.91  Aligned_cols=102  Identities=62%  Similarity=1.192  Sum_probs=91.1

Q ss_pred             CCcccccCCCCCCCeeeeCCCCCcccccccccccccCCCCCCccccchhhhhhcCCCCCCcccccCCcccccccccCCCC
Q psy8832          36 DIKECVNCAANSTPLWRRDGTGHHLCNACGLYNRINGVNRPPVRTNQKKALQQTGNKRSGVSCANCSTTCTTLWRRNNNG  115 (144)
Q Consensus        36 ~~~~C~~C~t~~tp~wrr~~~g~~lCnaCgly~r~~g~~RP~~k~kkkka~~~s~~k~~~~~C~nC~t~~t~~WR~~~~g  115 (144)
                      ..++|+|||+++||+||+|++|++||||||||+++++.++|+.+++++.    ......+..|+||++++||+||++++|
T Consensus         4 ~~~~C~~Cg~~~Tp~WRr~~~g~~lCnaCgl~~Kl~G~nRP~~KpKKR~----~~~~~~~~~C~~C~t~~tp~WRr~~~g   79 (115)
T 4hc9_A            4 MGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRL----SAARRAGTSCANCQTTTTTLWRRNANG   79 (115)
T ss_dssp             --CCCTTTCCSCCSSCEECTTSCEECHHHHHHHHHHSSCCCCSSCCCCC----CCCCCTTCCCTTTCCSCCSSCEECTTS
T ss_pred             CCCCCCCCCCccCCcceECCCCCCcCcchhhhhhhcccccccccccccc----cccccccccCCCcCCCCcceeEECCCC
Confidence            4679999999999999999999999999999999999999987665432    344567789999999999999999999


Q ss_pred             CcccchhHHHHHhhCCCCcccccccc
Q psy8832         116 EPVCNACGLYFKLHNVFTILFYNITK  141 (144)
Q Consensus       116 ~~lCnaCglyy~~~~~~Rp~~l~~~~  141 (144)
                      ++|||||||||++|+++||++|+++.
T Consensus        80 ~~lCNaCgl~~~~~~~~rp~~~~~~~  105 (115)
T 4hc9_A           80 DPVCNACGLYYKLHNINRPLTMKKEG  105 (115)
T ss_dssp             CEECHHHHHHHHHHSSCCCGGGCCSS
T ss_pred             CCcchHHHHHHHHhCCCCCccccccc
Confidence            99999999999999999999998653
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 144
d3gata_66 g.39.1.1 (A:) Erythroid transcription factor GATA- 3e-15
d3gata_66 g.39.1.1 (A:) Erythroid transcription factor GATA- 1e-13
d1y0ja139 g.39.1.1 (A:200-238) Erythroid transcription facto 1e-13
d1y0ja139 g.39.1.1 (A:200-238) Erythroid transcription facto 2e-13
d2vuti142 g.39.1.1 (I:671-712) Erythroid transcription facto 6e-13
d2vuti142 g.39.1.1 (I:671-712) Erythroid transcription facto 1e-12
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score = 63.8 bits (155), Expect = 3e-15
 Identities = 27/40 (67%), Positives = 33/40 (82%)

Query: 92  KRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNV 131
           KR+G  C+NC T+ TTLWRR+  G+PVCNACGLY+KLH V
Sbjct: 1   KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQV 40
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 99.87
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 99.84
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 99.8
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 99.77
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 99.76
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 99.73
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 93.48
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 92.39
d1neea237 Zinc-binding domain of translation initiation fact 91.97
d1k81a_36 Zinc-binding domain of translation initiation fact 87.97
d1neea237 Zinc-binding domain of translation initiation fact 85.24
d2zjrz158 Ribosomal protein L32p {Deinococcus radiodurans [T 80.67
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Emericella nidulans [TaxId: 162425]

Probab=99.87  E-value=1.2e-23  Score=123.45  Aligned_cols=41  Identities=56%  Similarity=1.155  Sum_probs=40.0

Q ss_pred             ccccCCcccccccccCCCCCcccchhHHHHHhhCCCCcccc
Q psy8832          97 SCANCSTTCTTLWRRNNNGEPVCNACGLYFKLHNVFTILFY  137 (144)
Q Consensus        97 ~C~nC~t~~t~~WR~~~~g~~lCnaCglyy~~~~~~Rp~~l  137 (144)
                      .|+||++++||+||++++|.+|||||||||++||++||++|
T Consensus         2 ~C~nC~tt~Tp~WRr~~~G~~lCNACGl~~k~~g~~RP~sl   42 (42)
T d2vuti1           2 TCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSL   42 (42)
T ss_dssp             CCSSSCCCCCSCCEECTTSCEECHHHHHHHHHHSSCCCCCC
T ss_pred             cCCCCCCCCCccceeCCCCCCchhhhhHHHHHcCCCCCCCC
Confidence            69999999999999999999999999999999999999997
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure