Diaphorina citri psyllid: psy8839


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MKERSSREEYTFFTVYLLGFDILVADECLIAPLGIFHPELLGLTGTKIVVTQSRAVSDPEDPHDGDYLRETSVS
ccccccccCEEEccccEEEEEEEEccEEEEcccccccccccccccccEEEEcccccccccccccHHHHHHcccc
*********YTFFTVYLLGFDILVADECLIAPLGIFHPELLGLTGTKIVVT**********PHDGDYLRET***
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKERSSREEYTFFTVYLLGFDILVADECLIAPLGIFHPELLGLTGTKIVVTQSRAVSDPEDPHDGDYLRETSVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 8 Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.confidentQ9VX09

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031011 [CC]Ino80 complexprobableGO:0033202, GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0097346, GO:0044428, GO:0044424, GO:0044427, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FO0, chain A
Confidence level:confident
Coverage over the Query: 10-53
View the alignment between query and template
View the model in PyMOL