Diaphorina citri psyllid: psy8843


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MIPNKKEEDEQLIRPEYKKKKTQNESVQVVVRCRPMNSSEISGGYDKVVDMWPNRGVIEISNPKVKEKKIKDLNIL
ccccccHHHHccccccccccccccccEEEEEEccccccHHHHcccccEEEECccccEEEEEcccccccccccCECc
****************************VVVRCRPMNSSEISGGYDKVVDMWPNRGVIEIS******K********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPNKKEEDEQLIRPEYKKKKTQNESVQVVVRCRPMNSSEISGGYDKVVDMWPNRGVIEISNPKVKEKKIKDLNIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kinesin-II 95 kDa subunit confidentP46871
Kinesin-like protein Klp68D Plus-end directed microtubule motor that may be used for anterograde axonal transport and could conceivably move cargos in fly neurons different than those moved by kinesin heavy chain or other plus-end directed motors.confidentQ29DY1
Kinesin-like protein Klp68D Plus-end directed microtubule motor that may be used for anterograde axonal transport and could conceivably move cargos in fly neurons different than those moved by kinesin heavy chain or other plus-end directed motors.confidentP46867

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0016939 [CC]kinesin II complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0005871, GO:0043228, GO:0005622, GO:0005875, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B6U, chain A
Confidence level:very confident
Coverage over the Query: 35-76
View the alignment between query and template
View the model in PyMOL