Diaphorina citri psyllid: psy8844


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
MKKQNIRTLSLIVCTFTYLLIGASVFDALESQTENRRWTTLSDIEKMIMNKYNISPDDFKLLETLILKSEPHKAGQQWKFAGSFYYATTVLTTIGYGHSTPNTIGGKLFTMFYAMVGIPLGLVMFQSIGERLNKLSSVVIRKAKRLSGCTEIEATEINLICVVTTLSSLTIAVGAAAFSRYEGWTYFDSVYYCFITLTTIGFGDMVALQKDNALDTKPEYVIFALIFILFGLAIVAASLNLLVLRFVTMNTEDERRDEAEALQAAQGAVRLEGDVITADGSILSGQLGENNAVYHNISTTTSMCTCTCNCFRRDSDLQLGPTVSMPVDSLSCDQLSMEEYEQVMEVLMVPRTR
ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEcCCccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccc
*KKQNIRTLSLIVCTFTYLLIGASVFDALESQTENRRWTTLSDIEKMIMNKYNISPDDFKLLETLILKSEPHKAGQQWKFAGSFYYATTVLTTIGYGHSTPNTIGGKLFTMFYAMVGIPLGLVMFQSIGERLNKLSSVVIRKAKRLSGCTEIEATEINLICVVTTLSSLTIAVGAAAFSRYEGWTYFDSVYYCFITLTTIGFGDMVALQKDNALDTKPEYVIFALIFILFGLAIVAASLNLLVLRFVTMNTED*************GAVRLEGDVIT*****************HNISTTTSMCTCTCNCFRRDSDLQLGPTVS*****************************
xxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKQNIRTLSLIVCTFTYLLIGASVFDALESQTENRRWTTLSDIEKMIMNKYNISPDDFKLLETLILKSEPHKAGQQWKFAGSFYYATTVLTTIGYGHSTPNTIGGKLFTMFYAMVGIPLGLVMFQSIGERLNKLSSVVIRKAKRLSGCTEIEATEINLICVVTTLSSLTIAVGAAAFSRYEGWTYFDSVYYCFITLTTIGFGDMVALQKDNALDTKPEYVIFALIFILFGLAIVAASLNLLVLRFVTMNTEDERRDEAEALQAAQGAVRLEGDVITADGSILSGQLGENNAVYHNISTTTSMCTCTCNCFRRDSDLQLGPTVSMPVDSLSCDQLSMEEYEQVMEVLMVPRTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Two pore potassium channel protein sup-9 Potassium channel involved in coordination of muscle contraction.very confidentO17185
Potassium channel subfamily K member 3 pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.confidentO14649
Potassium channel subfamily K member 9 pH-dependent, voltage-insensitive, background potassium channel protein.confidentQ9JL58

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005267 [MF]potassium channel activityconfidentGO:0022891, GO:0022890, GO:0022892, GO:0005261, GO:0005215, GO:0005216, GO:0008324, GO:0022857, GO:0015075, GO:0015077, GO:0015267, GO:0003674, GO:0022803, GO:0046873, GO:0022838, GO:0015079
GO:0055120 [CC]striated muscle dense bodyconfidentGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0036195 [CC]muscle cell projection membraneconfidentGO:0016020, GO:0044464, GO:0044463, GO:0031253, GO:0005623, GO:0005575, GO:0071944, GO:0036194, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0005887 [CC]integral to plasma membraneconfidentGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0071805 [BP]potassium ion transmembrane transportconfidentGO:0006810, GO:0071804, GO:0006813, GO:0006812, GO:0006811, GO:0009987, GO:0015672, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0030001, GO:0051179, GO:0051234, GO:0055085, GO:0044699
GO:0006937 [BP]regulation of muscle contractionprobableGO:0044057, GO:0008150, GO:0090257, GO:0051239, GO:0065007, GO:0050789
GO:0005252 [MF]open rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0005249, GO:0022839, GO:0022838, GO:0015079
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0034765 [BP]regulation of ion transmembrane transportprobableGO:0051049, GO:0050794, GO:0065007, GO:0034762, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0008076 [CC]voltage-gated potassium channel complexprobableGO:0043234, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034702, GO:0034705, GO:0071944, GO:0034703, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0071294 [BP]cellular response to zinc ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0010043, GO:0042221, GO:0010035, GO:0044699
GO:0090102 [BP]cochlea developmentprobableGO:0032502, GO:0048839, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0007275, GO:0044699
GO:0071456 [BP]cellular response to hypoxiaprobableGO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0051481 [BP]reduction of cytosolic calcium ion concentrationprobableGO:0019725, GO:0072507, GO:0072503, GO:0051480, GO:0006874, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0006875, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UKM, chain A
Confidence level:very confident
Coverage over the Query: 3-251
View the alignment between query and template
View the model in PyMOL
Template: 1LNQ, chain A
Confidence level:very confident
Coverage over the Query: 169-246,267-283
View the alignment between query and template
View the model in PyMOL