Diaphorina citri psyllid: psy8849


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MNINKRQIIVIKILKDIKAQDIKVYDTSNLTNLFDRITIASGSSKRQINALAVSIRKNIKNINNNIVNIEGKKSSEWLLLDLGDIIIHIMNPYIRNMYNLEEIWGEKEIKFN
ccHHHHHHHHHHHHHcccccccEEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccEEEEEccccHHccccHHHHccccccccc
***NKRQIIVIKILKDIKAQDIKVYDTSNLTNLFDRITIASGSSKRQINALAVSIRKNIKNINNNIVNIEGKKSSEWLLLDLGDIIIHIMNPYIRNMYNLEEIWGEK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNINKRQIIVIKILKDIKAQDIKVYDTSNLTNLFDRITIASGSSKRQINALAVSIRKNIKNINNNIVNIEGKKSSEWLLLDLGDIIIHIMNPYIRNMYNLEEIWGEKEIKFN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosomal silencing factor RsfS confidentP0AAT7
Ribosomal silencing factor RsfS confidentP0AAT8
Ribosomal silencing factor RsfS Functions as a ribosomal silencing factor. Interacts with ribosomal protein L14 (rplN), blocking formation of intersubunit bridge B8. Prevents association of the 30S and 50S ribosomal subunits and the formation of functional ribosomes, thus repressing translation.confidentQ7P0P8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043023 [MF]ribosomal large subunit bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0090071 [BP]negative regulation of ribosome biogenesisprobableGO:0090069, GO:0050794, GO:0008150, GO:0044087, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0017148 [BP]negative regulation of translationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0006417, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ID1, chain A
Confidence level:very confident
Coverage over the Query: 2-110
View the alignment between query and template
View the model in PyMOL