Diaphorina citri psyllid: psy8857


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MAKVLNNTNARIRKKIKKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSRKSTPFAAQVAAESAGKIAIEHGIKNLEVRIKGPGPGRESSVRALNNLGIKITQIEDVTPIPHNGCRPSKRRRV
ccccccccccccccccccEEcccEEEEEcccccEEEEEEcccccEEEEECcccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHcccEEEEEECccccccccccccccccc
************RKKIKKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSRKSTPFAAQVAAESAGKIAIEHGIKNLEVRIKGPGPGRESSVRALNNLGIKITQIEDVTPIPHNGCRPS*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKVLNNTNARIRKKIKKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSRKSTPFAAQVAAESAGKIAIEHGIKNLEVRIKGPGPGRESSVRALNNLGIKITQIEDVTPIPHNGCRPSKRRRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S11 Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome.very confidentB2UEJ5
30S ribosomal protein S11 Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome.very confidentB1JU46
30S ribosomal protein S11 Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome.very confidentQ46WG7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022627 [CC]cytosolic small ribosomal subunitconfidentGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0070181 [MF]SSU rRNA bindingconfidentGO:0097159, GO:0019843, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030686 [CC]90S preribosomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0032040 [CC]small-subunit processomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0040007 [BP]growthprobableGO:0008150
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030218 [BP]erythrocyte differentiationprobableGO:0030154, GO:0042592, GO:0007275, GO:0044699, GO:0048869, GO:0002262, GO:0008150, GO:0048513, GO:0065007, GO:0048534, GO:0065008, GO:0032502, GO:0034101, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0030097, GO:0002520, GO:0048872, GO:0044707, GO:0048856, GO:0002376, GO:0030099, GO:0048731
GO:0045182 [MF]translation regulator activityprobableGO:0003674
GO:0000028 [BP]ribosomal small subunit assemblyprobableGO:0006996, GO:0071826, GO:0022607, GO:0042274, GO:0043933, GO:0009987, GO:0042255, GO:0042254, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0044699, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0071840, GO:0044085
GO:0048027 [MF]mRNA 5'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006417 [BP]regulation of translationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBN, chain K
Confidence level:very confident
Coverage over the Query: 17-133
View the alignment between query and template
View the model in PyMOL