Psyllid ID: psy8857
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| 300309480 | 134 | 30S ribosomal protein S11 [Herbaspirillu | 1.0 | 0.992 | 0.805 | 3e-56 | |
| 398833117 | 134 | 30S ribosomal protein S11 [Herbaspirillu | 1.0 | 0.992 | 0.783 | 1e-54 | |
| 238025956 | 133 | 30S ribosomal protein S11 [Burkholderia | 1.0 | 1.0 | 0.759 | 2e-54 | |
| 332286120 | 133 | 30S ribosomal protein S11 [Pusillimonas | 1.0 | 1.0 | 0.751 | 2e-54 | |
| 167564392 | 133 | ribosomal protein S11 [Burkholderia okla | 1.0 | 1.0 | 0.751 | 8e-54 | |
| 53720797 | 133 | 30S ribosomal protein S11 [Burkholderia | 1.0 | 1.0 | 0.751 | 1e-53 | |
| 83748173 | 133 | SSU ribosomal protein S11P [Ralstonia so | 1.0 | 1.0 | 0.751 | 1e-53 | |
| 17547714 | 133 | 30S ribosomal protein S11 [Ralstonia sol | 1.0 | 1.0 | 0.751 | 1e-53 | |
| 167587748 | 133 | ribosomal protein S11 [Burkholderia ubon | 1.0 | 1.0 | 0.744 | 1e-53 | |
| 91785441 | 134 | 30S ribosomal protein S11 [Burkholderia | 1.0 | 0.992 | 0.753 | 1e-53 |
| >gi|300309480|ref|YP_003773572.1| 30S ribosomal protein S11 [Herbaspirillum seropedicae SmR1] gi|409408725|ref|ZP_11257160.1| 30S ribosomal protein S11 [Herbaspirillum sp. GW103] gi|415943235|ref|ZP_11556035.1| 30S ribosomal protein S11 [Herbaspirillum frisingense GSF30] gi|300072265|gb|ADJ61664.1| 30S ribosomal subunit S11 protein [Herbaspirillum seropedicae SmR1] gi|386432047|gb|EIJ44875.1| 30S ribosomal protein S11 [Herbaspirillum sp. GW103] gi|407758751|gb|EKF68535.1| 30S ribosomal protein S11 [Herbaspirillum frisingense GSF30] | Back alignment and taxonomy information |
|---|
Score = 223 bits (567), Expect = 3e-56, Method: Compositional matrix adjust.
Identities = 108/134 (80%), Positives = 121/134 (90%), Gaps = 1/134 (0%)
Query: 1 MAKVLNNTNA-RIRKKIKKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGS 59
MAK NN A R+RKK+KK++ EG+AH+HASFNNTIITITDR+G LSWA+SG FKGS
Sbjct: 1 MAKSPNNAAASRVRKKVKKNVAEGIAHVHASFNNTIITITDRQGNALSWATSGGAGFKGS 60
Query: 60 RKSTPFAAQVAAESAGKIAIEHGIKNLEVRIKGPGPGRESSVRALNNLGIKITQIEDVTP 119
RKSTPFAAQVAAESAGK+AIE GIKNLEVRIKGPGPGRES+VRALNNLGIKITQI+DVTP
Sbjct: 61 RKSTPFAAQVAAESAGKVAIECGIKNLEVRIKGPGPGRESAVRALNNLGIKITQIQDVTP 120
Query: 120 IPHNGCRPSKRRRV 133
+PHNGCRP KRRR+
Sbjct: 121 VPHNGCRPPKRRRI 134
|
Source: Herbaspirillum seropedicae SmR1 Species: Herbaspirillum seropedicae Genus: Herbaspirillum Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|398833117|ref|ZP_10591257.1| 30S ribosomal protein S11 [Herbaspirillum sp. YR522] gi|398222103|gb|EJN08491.1| 30S ribosomal protein S11 [Herbaspirillum sp. YR522] | Back alignment and taxonomy information |
|---|
| >gi|238025956|ref|YP_002910187.1| 30S ribosomal protein S11 [Burkholderia glumae BGR1] gi|237875150|gb|ACR27483.1| 30S ribosomal protein S11 [Burkholderia glumae BGR1] | Back alignment and taxonomy information |
|---|
| >gi|332286120|ref|YP_004418031.1| 30S ribosomal protein S11 [Pusillimonas sp. T7-7] gi|330430073|gb|AEC21407.1| 30S ribosomal protein S11 [Pusillimonas sp. T7-7] | Back alignment and taxonomy information |
|---|
| >gi|167564392|ref|ZP_02357308.1| ribosomal protein S11 [Burkholderia oklahomensis EO147] gi|167571539|ref|ZP_02364413.1| ribosomal protein S11 [Burkholderia oklahomensis C6786] | Back alignment and taxonomy information |
|---|
| >gi|53720797|ref|YP_109783.1| 30S ribosomal protein S11 [Burkholderia pseudomallei K96243] gi|53723830|ref|YP_104142.1| 30S ribosomal protein S11 [Burkholderia mallei ATCC 23344] gi|76809500|ref|YP_335116.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1710b] gi|78064948|ref|YP_367717.1| 30S ribosomal protein S11 [Burkholderia sp. 383] gi|83719823|ref|YP_443548.1| 30S ribosomal protein S11 [Burkholderia thailandensis E264] gi|107024279|ref|YP_622606.1| 30S ribosomal protein S11 [Burkholderia cenocepacia AU 1054] gi|115350346|ref|YP_772185.1| 30S ribosomal protein S11 [Burkholderia ambifaria AMMD] gi|116688396|ref|YP_834019.1| 30S ribosomal protein S11 [Burkholderia cenocepacia HI2424] gi|121600264|ref|YP_994432.1| 30S ribosomal protein S11 [Burkholderia mallei SAVP1] gi|124383942|ref|YP_001027919.1| 30S ribosomal protein S11 [Burkholderia mallei NCTC 10229] gi|126438369|ref|YP_001060726.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 668] gi|126449962|ref|YP_001083014.1| 30S ribosomal protein S11 [Burkholderia mallei NCTC 10247] gi|126455195|ref|YP_001068010.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1106a] gi|134283319|ref|ZP_01770020.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 305] gi|134294467|ref|YP_001118202.1| 30S ribosomal protein S11 [Burkholderia vietnamiensis G4] gi|161523453|ref|YP_001578465.1| 30S ribosomal protein S11 [Burkholderia multivorans ATCC 17616] gi|167001675|ref|ZP_02267467.1| 30S ribosomal protein S11 [Burkholderia mallei PRL-20] gi|167582599|ref|ZP_02375473.1| ribosomal protein S11 [Burkholderia thailandensis TXDOH] gi|167620713|ref|ZP_02389344.1| ribosomal protein S11 [Burkholderia thailandensis Bt4] gi|167721553|ref|ZP_02404789.1| ribosomal protein S11 [Burkholderia pseudomallei DM98] gi|167740527|ref|ZP_02413301.1| ribosomal protein S11 [Burkholderia pseudomallei 14] gi|167817732|ref|ZP_02449412.1| ribosomal protein S11 [Burkholderia pseudomallei 91] gi|167826129|ref|ZP_02457600.1| ribosomal protein S11 [Burkholderia pseudomallei 9] gi|167838188|ref|ZP_02465047.1| ribosomal protein S11 [Burkholderia thailandensis MSMB43] gi|167847641|ref|ZP_02473149.1| ribosomal protein S11 [Burkholderia pseudomallei B7210] gi|167896213|ref|ZP_02483615.1| ribosomal protein S11 [Burkholderia pseudomallei 7894] gi|167904595|ref|ZP_02491800.1| ribosomal protein S11 [Burkholderia pseudomallei NCTC 13177] gi|167912860|ref|ZP_02499951.1| ribosomal protein S11 [Burkholderia pseudomallei 112] gi|167920819|ref|ZP_02507910.1| ribosomal protein S11 [Burkholderia pseudomallei BCC215] gi|170700718|ref|ZP_02891713.1| ribosomal protein S11 [Burkholderia ambifaria IOP40-10] gi|170731706|ref|YP_001763653.1| 30S ribosomal protein S11 [Burkholderia cenocepacia MC0-3] gi|171318372|ref|ZP_02907530.1| ribosomal protein S11 [Burkholderia ambifaria MEX-5] gi|172059365|ref|YP_001807017.1| 30S ribosomal protein S11 [Burkholderia ambifaria MC40-6] gi|189351774|ref|YP_001947402.1| 30S ribosomal protein S11 [Burkholderia multivorans ATCC 17616] gi|206558665|ref|YP_002229425.1| 30S ribosomal protein S11 [Burkholderia cenocepacia J2315] gi|217424730|ref|ZP_03456227.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 576] gi|221201589|ref|ZP_03574627.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD2M] gi|221207336|ref|ZP_03580346.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD2] gi|221213474|ref|ZP_03586449.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD1] gi|226198281|ref|ZP_03793852.1| 30S ribosomal protein S11 [Burkholderia pseudomallei Pakistan 9] gi|237814121|ref|YP_002898572.1| 30S ribosomal protein S11 [Burkholderia pseudomallei MSHR346] gi|238562960|ref|ZP_00439642.2| 30S ribosomal protein S11 [Burkholderia mallei GB8 horse 4] gi|242317635|ref|ZP_04816651.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1106b] gi|254175001|ref|ZP_04881662.1| 30S ribosomal protein S11 [Burkholderia mallei ATCC 10399] gi|254180363|ref|ZP_04886961.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1655] gi|254190326|ref|ZP_04896834.1| 30S ribosomal protein S11 [Burkholderia pseudomallei Pasteur 52237] gi|254198467|ref|ZP_04904888.1| 30S ribosomal protein S11 [Burkholderia pseudomallei S13] gi|254201215|ref|ZP_04907579.1| 30S ribosomal protein S11 [Burkholderia mallei FMH] gi|254206556|ref|ZP_04912907.1| 30S ribosomal protein S11 [Burkholderia mallei JHU] gi|254246579|ref|ZP_04939900.1| Ribosomal protein S11 [Burkholderia cenocepacia PC184] gi|254253496|ref|ZP_04946814.1| Ribosomal protein S11 [Burkholderia dolosa AUO158] gi|254260898|ref|ZP_04951952.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1710a] gi|254300600|ref|ZP_04968045.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 406e] gi|254357094|ref|ZP_04973368.1| 30S ribosomal protein S11 [Burkholderia mallei 2002721280] gi|257137666|ref|ZP_05585928.1| 30S ribosomal protein S11 [Burkholderia thailandensis E264] gi|386863448|ref|YP_006276397.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1026b] gi|387901054|ref|YP_006331393.1| 30S ribosomal protein S11 [Burkholderia sp. KJ006] gi|402567893|ref|YP_006617238.1| 30S ribosomal protein S11 [Burkholderia cepacia GG4] gi|403520443|ref|YP_006654577.1| 30S ribosomal protein S11 [Burkholderia pseudomallei BPC006] gi|416902467|ref|ZP_11930478.1| 30S ribosomal protein S11 [Burkholderia sp. TJI49] gi|418392855|ref|ZP_12968605.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 354a] gi|418534597|ref|ZP_13100436.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1026a] gi|418542141|ref|ZP_13107595.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1258a] gi|418548666|ref|ZP_13113774.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1258b] gi|418554602|ref|ZP_13119382.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 354e] gi|421479193|ref|ZP_15926908.1| 30S ribosomal protein S11 [Burkholderia multivorans CF2] gi|424907044|ref|ZP_18330535.1| 30S ribosomal protein S11 [Burkholderia thailandensis MSMB43] gi|444357347|ref|ZP_21158890.1| 30S ribosomal protein S11 [Burkholderia cenocepacia BC7] gi|444366801|ref|ZP_21166812.1| 30S ribosomal protein S11 [Burkholderia cenocepacia K56-2Valvano] gi|59798631|sp|Q62GM9.1|RS11_BURMA RecName: Full=30S ribosomal protein S11 gi|59798642|sp|Q63Q35.1|RS11_BURPS RecName: Full=30S ribosomal protein S11 gi|91207733|sp|Q3JMT7.1|RS11_BURP1 RecName: Full=30S ribosomal protein S11 gi|91207734|sp|Q39KE3.1|RS11_BURS3 RecName: Full=30S ribosomal protein S11 gi|122324242|sp|Q0BJ22.1|RS11_BURCM RecName: Full=30S ribosomal protein S11 gi|123244314|sp|Q1BRX2.1|RS11_BURCA RecName: Full=30S ribosomal protein S11 gi|123726557|sp|Q2SU51.1|RS11_BURTA RecName: Full=30S ribosomal protein S11 gi|152060579|sp|A0K3P9.1|RS11_BURCH RecName: Full=30S ribosomal protein S11 gi|152060580|sp|A3P089.1|RS11_BURP0 RecName: Full=30S ribosomal protein S11 gi|166231803|sp|A3MRX8.1|RS11_BURM7 RecName: Full=30S ribosomal protein S11 gi|166231804|sp|A2S7K0.1|RS11_BURM9 RecName: Full=30S ribosomal protein S11 gi|166231805|sp|A1V879.1|RS11_BURMS RecName: Full=30S ribosomal protein S11 gi|166231806|sp|A3NEF5.1|RS11_BURP6 RecName: Full=30S ribosomal protein S11 gi|166231807|sp|A4JAR4.1|RS11_BURVG RecName: Full=30S ribosomal protein S11 gi|226708337|sp|B1YRQ3.1|RS11_BURA4 RecName: Full=30S ribosomal protein S11 gi|226708338|sp|B1JU46.1|RS11_BURCC RecName: Full=30S ribosomal protein S11 gi|226708339|sp|B4E5E4.1|RS11_BURCJ RecName: Full=30S ribosomal protein S11 gi|226708340|sp|A9ADL7.1|RS11_BURM1 RecName: Full=30S ribosomal protein S11 gi|52211211|emb|CAH37200.1| 30S ribosomal protein S11 [Burkholderia pseudomallei K96243] gi|52427253|gb|AAU47846.1| ribosomal protein S11 [Burkholderia mallei ATCC 23344] gi|76578953|gb|ABA48428.1| ribosomal protein S11 [Burkholderia pseudomallei 1710b] gi|77965693|gb|ABB07073.1| SSU ribosomal protein S11P [Burkholderia sp. 383] gi|83653648|gb|ABC37711.1| ribosomal protein S11 [Burkholderia thailandensis E264] gi|105894468|gb|ABF77633.1| SSU ribosomal protein S11P [Burkholderia cenocepacia AU 1054] gi|115280334|gb|ABI85851.1| SSU ribosomal protein S11P [Burkholderia ambifaria AMMD] gi|116646485|gb|ABK07126.1| SSU ribosomal protein S11P [Burkholderia cenocepacia HI2424] gi|121229074|gb|ABM51592.1| 30S ribosomal protein S11 [Burkholderia mallei SAVP1] gi|124291962|gb|ABN01231.1| 30S ribosomal protein S11 [Burkholderia mallei NCTC 10229] gi|124871355|gb|EAY63071.1| Ribosomal protein S11 [Burkholderia cenocepacia PC184] gi|124896105|gb|EAY69985.1| Ribosomal protein S11 [Burkholderia dolosa AUO158] gi|126217862|gb|ABN81368.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 668] gi|126228837|gb|ABN92377.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1106a] gi|126242832|gb|ABO05925.1| 30S ribosomal protein S11 [Burkholderia mallei NCTC 10247] gi|134137624|gb|ABO53367.1| SSU ribosomal protein S11P [Burkholderia vietnamiensis G4] gi|134245514|gb|EBA45607.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 305] gi|147747109|gb|EDK54185.1| 30S ribosomal protein S11 [Burkholderia mallei FMH] gi|147752098|gb|EDK59164.1| 30S ribosomal protein S11 [Burkholderia mallei JHU] gi|148026158|gb|EDK84243.1| 30S ribosomal protein S11 [Burkholderia mallei 2002721280] gi|157810512|gb|EDO87682.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 406e] gi|157938002|gb|EDO93672.1| 30S ribosomal protein S11 [Burkholderia pseudomallei Pasteur 52237] gi|160340882|gb|ABX13968.1| ribosomal protein S11 [Burkholderia multivorans ATCC 17616] gi|160696046|gb|EDP86016.1| 30S ribosomal protein S11 [Burkholderia mallei ATCC 10399] gi|169655207|gb|EDS87900.1| 30S ribosomal protein S11 [Burkholderia pseudomallei S13] gi|169814948|gb|ACA89531.1| ribosomal protein S11 [Burkholderia cenocepacia MC0-3] gi|170134388|gb|EDT02721.1| ribosomal protein S11 [Burkholderia ambifaria IOP40-10] gi|171096450|gb|EDT41349.1| ribosomal protein S11 [Burkholderia ambifaria MEX-5] gi|171991882|gb|ACB62801.1| ribosomal protein S11 [Burkholderia ambifaria MC40-6] gi|184210902|gb|EDU07945.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1655] gi|189335796|dbj|BAG44866.1| small subunit ribosomal protein S11 [Burkholderia multivorans ATCC 17616] gi|198034702|emb|CAR50569.1| 30S ribosomal protein S11 [Burkholderia cenocepacia J2315] gi|217392186|gb|EEC32211.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 576] gi|221166926|gb|EED99397.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD1] gi|221172924|gb|EEE05361.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD2] gi|221178405|gb|EEE10814.1| 30S ribosomal protein S11 [Burkholderia multivorans CGD2M] gi|225929801|gb|EEH25817.1| 30S ribosomal protein S11 [Burkholderia pseudomallei Pakistan 9] gi|237506148|gb|ACQ98466.1| 30S ribosomal protein S11 [Burkholderia pseudomallei MSHR346] gi|238521644|gb|EEP85094.1| 30S ribosomal protein S11 [Burkholderia mallei GB8 horse 4] gi|242140874|gb|EES27276.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1106b] gi|243062572|gb|EES44758.1| 30S ribosomal protein S11 [Burkholderia mallei PRL-20] gi|254219587|gb|EET08971.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1710a] gi|325529702|gb|EGD06565.1| 30S ribosomal protein S11 [Burkholderia sp. TJI49] gi|385356320|gb|EIF62437.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1258a] gi|385357628|gb|EIF63674.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1258b] gi|385358966|gb|EIF64946.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1026a] gi|385370078|gb|EIF75351.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 354e] gi|385374933|gb|EIF79736.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 354a] gi|385660576|gb|AFI67999.1| 30S ribosomal protein S11 [Burkholderia pseudomallei 1026b] gi|387575946|gb|AFJ84662.1| SSU ribosomal protein S11p (S14e) [Burkholderia sp. KJ006] gi|390927401|gb|EIP84810.1| 30S ribosomal protein S11 [Burkholderia thailandensis MSMB43] gi|400223474|gb|EJO53771.1| 30S ribosomal protein S11 [Burkholderia multivorans CF2] gi|402249090|gb|AFQ49544.1| 30S ribosomal protein S11 [Burkholderia cepacia GG4] gi|403076085|gb|AFR17665.1| 30S ribosomal protein S11 [Burkholderia pseudomallei BPC006] gi|443603961|gb|ELT71934.1| 30S ribosomal protein S11 [Burkholderia cenocepacia K56-2Valvano] gi|443606456|gb|ELT74236.1| 30S ribosomal protein S11 [Burkholderia cenocepacia BC7] | Back alignment and taxonomy information |
|---|
| >gi|83748173|ref|ZP_00945200.1| SSU ribosomal protein S11P [Ralstonia solanacearum UW551] gi|187930340|ref|YP_001900827.1| 30S ribosomal protein S11 [Ralstonia pickettii 12J] gi|207744552|ref|YP_002260944.1| 30s ribosomal protein s11 [Ralstonia solanacearum IPO1609] gi|241664508|ref|YP_002982868.1| 30S ribosomal protein S11 [Ralstonia pickettii 12D] gi|300690184|ref|YP_003751179.1| 30S ribosomal subunit protein S11 [Ralstonia solanacearum PSI07] gi|300702804|ref|YP_003744405.1| 30S ribosomal protein S11 [Ralstonia solanacearum CFBP2957] gi|309782858|ref|ZP_07677578.1| 30S ribosomal protein S11 [Ralstonia sp. 5_7_47FAA] gi|386332171|ref|YP_006028340.1| 30S ribosomal protein S11 [Ralstonia solanacearum Po82] gi|404397554|ref|ZP_10989344.1| 30S ribosomal protein S11 [Ralstonia sp. 5_2_56FAA] gi|421895876|ref|ZP_16326275.1| 30s ribosomal protein s11 [Ralstonia solanacearum MolK2] gi|226708405|sp|B2UEJ5.1|RS11_RALPJ RecName: Full=30S ribosomal protein S11 gi|83725141|gb|EAP72292.1| SSU ribosomal protein S11P [Ralstonia solanacearum UW551] gi|187727230|gb|ACD28395.1| ribosomal protein S11 [Ralstonia pickettii 12J] gi|206587041|emb|CAQ17625.1| 30s ribosomal protein s11 [Ralstonia solanacearum MolK2] gi|206595958|emb|CAQ62885.1| 30s ribosomal protein s11 [Ralstonia solanacearum IPO1609] gi|240866535|gb|ACS64196.1| ribosomal protein S11 [Ralstonia pickettii 12D] gi|299065439|emb|CBJ36608.1| 30S ribosomal subunit protein S11 [Ralstonia solanacearum CMR15] gi|299070466|emb|CBJ41761.1| 30S ribosomal subunit protein S11 [Ralstonia solanacearum CFBP2957] gi|299077244|emb|CBJ49870.1| 30S ribosomal subunit protein S11 [Ralstonia solanacearum PSI07] gi|308918282|gb|EFP63959.1| 30S ribosomal protein S11 [Ralstonia sp. 5_7_47FAA] gi|334194619|gb|AEG67804.1| 30S ribosomal protein S11 [Ralstonia solanacearum Po82] gi|344168990|emb|CCA81311.1| 30S ribosomal subunit protein S11 [blood disease bacterium R229] gi|344172707|emb|CCA85361.1| 30S ribosomal subunit protein S11 [Ralstonia syzygii R24] gi|348612675|gb|EGY62289.1| 30S ribosomal protein S11 [Ralstonia sp. 5_2_56FAA] | Back alignment and taxonomy information |
|---|
| >gi|17547714|ref|NP_521116.1| 30S ribosomal protein S11 [Ralstonia solanacearum GMI1000] gi|48474566|sp|Q8XV36.1|RS11_RALSO RecName: Full=30S ribosomal protein S11 gi|17430019|emb|CAD16704.1| probable 30s ribosomal protein s11 [Ralstonia solanacearum GMI1000] | Back alignment and taxonomy information |
|---|
| >gi|167587748|ref|ZP_02380136.1| ribosomal protein S11 [Burkholderia ubonensis Bu] | Back alignment and taxonomy information |
|---|
| >gi|91785441|ref|YP_560647.1| 30S ribosomal protein S11 [Burkholderia xenovorans LB400] gi|170695705|ref|ZP_02886847.1| ribosomal protein S11 [Burkholderia graminis C4D1M] gi|186477563|ref|YP_001859033.1| 30S ribosomal protein S11 [Burkholderia phymatum STM815] gi|187925592|ref|YP_001897234.1| 30S ribosomal protein S11 [Burkholderia phytofirmans PsJN] gi|209521362|ref|ZP_03270075.1| ribosomal protein S11 [Burkholderia sp. H160] gi|295677908|ref|YP_003606432.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1002] gi|307731231|ref|YP_003908455.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1003] gi|323527578|ref|YP_004229731.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1001] gi|377821867|ref|YP_004978238.1| 30S ribosomal protein S11 [Burkholderia sp. YI23] gi|385207770|ref|ZP_10034638.1| 30S ribosomal protein S11 [Burkholderia sp. Ch1-1] gi|390576173|ref|ZP_10256246.1| 30S ribosomal protein S11 [Burkholderia terrae BS001] gi|407714965|ref|YP_006835530.1| 30S ribosomal protein S11 [Burkholderia phenoliruptrix BR3459a] gi|413959405|ref|ZP_11398641.1| 30S ribosomal protein S11 [Burkholderia sp. SJ98] gi|420246436|ref|ZP_14749878.1| 30S ribosomal protein S11 [Burkholderia sp. BT03] gi|123167990|sp|Q13TJ4.1|RS11_BURXL RecName: Full=30S ribosomal protein S11 gi|91689395|gb|ABE32595.1| SSU ribosomal protein S11P [Burkholderia xenovorans LB400] gi|170139310|gb|EDT07496.1| ribosomal protein S11 [Burkholderia graminis C4D1M] gi|184194022|gb|ACC71987.1| ribosomal protein S11 [Burkholderia phymatum STM815] gi|187716786|gb|ACD18010.1| ribosomal protein S11 [Burkholderia phytofirmans PsJN] gi|209498182|gb|EDZ98324.1| ribosomal protein S11 [Burkholderia sp. H160] gi|295437751|gb|ADG16921.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1002] gi|307585766|gb|ADN59164.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1003] gi|323384580|gb|ADX56671.1| 30S ribosomal protein S11 [Burkholderia sp. CCGE1001] gi|357936702|gb|AET90261.1| 30S ribosomal protein S11 [Burkholderia sp. YI23] gi|385180108|gb|EIF29384.1| 30S ribosomal protein S11 [Burkholderia sp. Ch1-1] gi|389931854|gb|EIM93909.1| 30S ribosomal protein S11 [Burkholderia terrae BS001] gi|398074539|gb|EJL65680.1| 30S ribosomal protein S11 [Burkholderia sp. BT03] gi|407237149|gb|AFT87348.1| small subunit ribosomal protein S11 [Burkholderia phenoliruptrix BR3459a] gi|413940362|gb|EKS72325.1| 30S ribosomal protein S11 [Burkholderia sp. SJ98] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| TIGR_CMR|CPS_0624 | 129 | CPS_0624 "ribosomal protein S1 | 0.947 | 0.976 | 0.682 | 5.6e-45 | |
| TIGR_CMR|SO_0254 | 130 | SO_0254 "ribosomal protein S11 | 0.977 | 1.0 | 0.676 | 7.1e-45 | |
| UNIPROTKB|P66367 | 129 | rpsK "30S ribosomal protein S1 | 0.924 | 0.953 | 0.682 | 8.1e-44 | |
| TIGR_CMR|VC_2573 | 129 | VC_2573 "ribosomal protein S11 | 0.924 | 0.953 | 0.682 | 8.1e-44 | |
| UNIPROTKB|P0A7R9 | 129 | rpsK [Escherichia coli K-12 (t | 0.924 | 0.953 | 0.682 | 1.3e-43 | |
| TIGR_CMR|BA_0136 | 129 | BA_0136 "ribosomal protein S11 | 0.939 | 0.968 | 0.634 | 6.6e-42 | |
| TIGR_CMR|CHY_2283 | 129 | CHY_2283 "ribosomal protein S1 | 0.924 | 0.953 | 0.634 | 1.6e-40 | |
| TIGR_CMR|GSU_2833 | 131 | GSU_2833 "ribosomal protein S1 | 0.909 | 0.923 | 0.644 | 5.5e-38 | |
| TIGR_CMR|SPO_0510 | 130 | SPO_0510 "ribosomal protein S1 | 0.909 | 0.930 | 0.611 | 2.4e-37 | |
| UNIPROTKB|O06326 | 139 | rpsK "30S ribosomal protein S1 | 0.924 | 0.884 | 0.569 | 7.2e-36 |
| TIGR_CMR|CPS_0624 CPS_0624 "ribosomal protein S11" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Score = 473 (171.6 bits), Expect = 5.6e-45, P = 5.6e-45
Identities = 86/126 (68%), Positives = 105/126 (83%)
Query: 8 TNARIRKKIKKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSRKSTPFAA 67
T R RK++KK + +G+AHIHASFNNTI+T+TDR+G LSWA++G F+GSRKSTPFAA
Sbjct: 4 TPVRTRKRVKKQVADGMAHIHASFNNTIVTLTDRQGNALSWATAGGSGFRGSRKSTPFAA 63
Query: 68 QVAAESAGKIAIEHGIKNLEVRIKGPGPGRESSVRALNNLGIKITQIEDVTPIPHNGCRP 127
QVAA+ AG +A E G+KN+EV +KGPGPGRES++RALN G KIT I DVTPIPHNGCRP
Sbjct: 64 QVAADRAGAVAKEFGLKNIEVFVKGPGPGRESAIRALNAAGFKITNITDVTPIPHNGCRP 123
Query: 128 SKRRRV 133
K+RRV
Sbjct: 124 PKKRRV 129
|
|
| TIGR_CMR|SO_0254 SO_0254 "ribosomal protein S11" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P66367 rpsK "30S ribosomal protein S11" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2573 VC_2573 "ribosomal protein S11" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A7R9 rpsK [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_0136 BA_0136 "ribosomal protein S11" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_2283 CHY_2283 "ribosomal protein S11" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2833 GSU_2833 "ribosomal protein S11" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0510 SPO_0510 "ribosomal protein S11" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O06326 rpsK "30S ribosomal protein S11" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| PRK05309 | 128 | PRK05309, PRK05309, 30S ribosomal protein S11; Val | 4e-79 | |
| COG0100 | 129 | COG0100, RpsK, Ribosomal protein S11 [Translation, | 7e-65 | |
| TIGR03632 | 108 | TIGR03632, bact_S11, 30S ribosomal protein S11 | 2e-63 | |
| pfam00411 | 109 | pfam00411, Ribosomal_S11, Ribosomal protein S11 | 2e-54 | |
| CHL00041 | 116 | CHL00041, rps11, ribosomal protein S11 | 6e-53 | |
| PRK09607 | 132 | PRK09607, rps11p, 30S ribosomal protein S11P; Revi | 1e-33 | |
| TIGR03628 | 114 | TIGR03628, arch_S11P, archaeal ribosomal protein S | 6e-29 | |
| PTZ00129 | 149 | PTZ00129, PTZ00129, 40S ribosomal protein S14; Pro | 4e-21 |
| >gnl|CDD|180007 PRK05309, PRK05309, 30S ribosomal protein S11; Validated | Back alignment and domain information |
|---|
Score = 228 bits (585), Expect = 4e-79
Identities = 84/126 (66%), Positives = 104/126 (82%)
Query: 8 TNARIRKKIKKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSRKSTPFAA 67
++KK+KK+I GVAHIHA+FNNTI+TITDR+G +SWAS+G + FKGSRKSTP+AA
Sbjct: 3 KKKTVKKKVKKNIPSGVAHIHATFNNTIVTITDRQGNVISWASAGGLGFKGSRKSTPYAA 62
Query: 68 QVAAESAGKIAIEHGIKNLEVRIKGPGPGRESSVRALNNLGIKITQIEDVTPIPHNGCRP 127
QVAAE A K A EHG+K +EV +KGPG GRES++RAL G+++T I+DVTPIPHNGCRP
Sbjct: 63 QVAAEDAAKKAKEHGMKTVEVFVKGPGSGRESAIRALQAAGLEVTSIKDVTPIPHNGCRP 122
Query: 128 SKRRRV 133
KRRRV
Sbjct: 123 PKRRRV 128
|
Length = 128 |
| >gnl|CDD|223178 COG0100, RpsK, Ribosomal protein S11 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|188357 TIGR03632, bact_S11, 30S ribosomal protein S11 | Back alignment and domain information |
|---|
| >gnl|CDD|189537 pfam00411, Ribosomal_S11, Ribosomal protein S11 | Back alignment and domain information |
|---|
| >gnl|CDD|176982 CHL00041, rps11, ribosomal protein S11 | Back alignment and domain information |
|---|
| >gnl|CDD|236588 PRK09607, rps11p, 30S ribosomal protein S11P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132667 TIGR03628, arch_S11P, archaeal ribosomal protein S11P | Back alignment and domain information |
|---|
| >gnl|CDD|185465 PTZ00129, PTZ00129, 40S ribosomal protein S14; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| PRK05309 | 128 | 30S ribosomal protein S11; Validated | 100.0 | |
| COG0100 | 129 | RpsK Ribosomal protein S11 [Translation, ribosomal | 100.0 | |
| PRK09607 | 132 | rps11p 30S ribosomal protein S11P; Reviewed | 100.0 | |
| PF00411 | 110 | Ribosomal_S11: Ribosomal protein S11; InterPro: IP | 100.0 | |
| PTZ00129 | 149 | 40S ribosomal protein S14; Provisional | 100.0 | |
| TIGR03632 | 108 | bact_S11 30S ribosomal protein S11. This model des | 100.0 | |
| CHL00041 | 116 | rps11 ribosomal protein S11 | 100.0 | |
| TIGR03628 | 114 | arch_S11P archaeal ribosomal protein S11P. This mo | 100.0 | |
| PTZ00090 | 233 | 40S ribosomal protein S11; Provisional | 100.0 | |
| KOG0408|consensus | 190 | 100.0 | ||
| KOG0407|consensus | 139 | 99.95 | ||
| cd00432 | 103 | Ribosomal_L18_L5e Ribosomal L18/L5e: L18 (L5e) is | 98.25 | |
| PRK08569 | 193 | rpl18p 50S ribosomal protein L18P; Reviewed | 97.82 | |
| PF00861 | 119 | Ribosomal_L18p: Ribosomal L18p/L5e family; InterPr | 97.8 | |
| CHL00139 | 109 | rpl18 ribosomal protein L18; Validated | 97.79 | |
| TIGR00060 | 114 | L18_bact ribosomal protein L18, bacterial type. Th | 97.72 | |
| PRK05593 | 117 | rplR 50S ribosomal protein L18; Reviewed | 97.63 | |
| COG0256 | 125 | RplR Ribosomal protein L18 [Translation, ribosomal | 96.6 | |
| PTZ00032 | 211 | 60S ribosomal protein L18; Provisional | 96.11 | |
| PTZ00069 | 300 | 60S ribosomal protein L5; Provisional | 88.99 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 85.77 |
| >PRK05309 30S ribosomal protein S11; Validated | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-51 Score=301.73 Aligned_cols=117 Identities=70% Similarity=1.125 Sum_probs=114.5
Q ss_pred cceeeeeEEEEEcccCCeEEEEEcCCCCeEEeeecceeeecCCCCCCHHHHHHHHHHHHHHHHHcCCcEEEEEEeCCCCC
Q psy8857 17 KKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSRKSTPFAAQVAAESAGKIAIEHGIKNLEVRIKGPGPG 96 (133)
Q Consensus 17 ~~~~~~~il~I~~t~NNTiitlTd~~G~~l~~~S~G~~gfKg~kk~t~~Aa~~aa~~~~~~~~~~gi~~v~v~~kG~G~G 96 (133)
++++..|++||++|+||||||+||++|++++|+|||++||||++|+|||||+++++.+++++.++|++.|+|+|+|+|+|
T Consensus 12 ~~~~~~gi~hI~~t~NNTiitlTd~~G~~~~~~S~G~~gfKg~rK~T~~Aa~~aa~~~~~~~~~~gi~~v~v~ikG~G~G 91 (128)
T PRK05309 12 KKNIPSGVAHIHATFNNTIVTITDRQGNVISWASAGGLGFKGSRKSTPYAAQVAAEDAAKKAKEHGMKTVEVFVKGPGSG 91 (128)
T ss_pred ccccceeEEEEEccCCCEEEEEEcCCCCEEEEEecCccEeCCCccCCHHHHHHHHHHHHHHHHHcCCcEEEEEEECCCCc
Confidence 44688999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHhhcCceEEEEEecCCCCCCCCCCCCCCCC
Q psy8857 97 RESSVRALNNLGIKITQIEDVTPIPHNGCRPSKRRRV 133 (133)
Q Consensus 97 r~~~lk~L~~~gl~I~~I~D~TpiphnGcR~kK~RRv 133 (133)
|+++|++|..+|++|.+|+|+||+|||||||||+|||
T Consensus 92 r~~air~L~~~glkI~~I~D~TpiphNGcR~~K~RRv 128 (128)
T PRK05309 92 RESAIRALQAAGLEVTSIKDVTPIPHNGCRPPKRRRV 128 (128)
T ss_pred HHHHHHHHHHCCCEEEEEEEcCCCCCCCcCcCCCCCC
Confidence 9999999999999999999999999999999999997
|
|
| >COG0100 RpsK Ribosomal protein S11 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09607 rps11p 30S ribosomal protein S11P; Reviewed | Back alignment and domain information |
|---|
| >PF00411 Ribosomal_S11: Ribosomal protein S11; InterPro: IPR001971 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PTZ00129 40S ribosomal protein S14; Provisional | Back alignment and domain information |
|---|
| >TIGR03632 bact_S11 30S ribosomal protein S11 | Back alignment and domain information |
|---|
| >CHL00041 rps11 ribosomal protein S11 | Back alignment and domain information |
|---|
| >TIGR03628 arch_S11P archaeal ribosomal protein S11P | Back alignment and domain information |
|---|
| >PTZ00090 40S ribosomal protein S11; Provisional | Back alignment and domain information |
|---|
| >KOG0408|consensus | Back alignment and domain information |
|---|
| >KOG0407|consensus | Back alignment and domain information |
|---|
| >cd00432 Ribosomal_L18_L5e Ribosomal L18/L5e: L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit | Back alignment and domain information |
|---|
| >PRK08569 rpl18p 50S ribosomal protein L18P; Reviewed | Back alignment and domain information |
|---|
| >PF00861 Ribosomal_L18p: Ribosomal L18p/L5e family; InterPro: IPR005484 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >CHL00139 rpl18 ribosomal protein L18; Validated | Back alignment and domain information |
|---|
| >TIGR00060 L18_bact ribosomal protein L18, bacterial type | Back alignment and domain information |
|---|
| >PRK05593 rplR 50S ribosomal protein L18; Reviewed | Back alignment and domain information |
|---|
| >COG0256 RplR Ribosomal protein L18 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00032 60S ribosomal protein L18; Provisional | Back alignment and domain information |
|---|
| >PTZ00069 60S ribosomal protein L5; Provisional | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 133 | ||||
| 1vs5_K | 129 | Crystal Structure Of The Bacterial Ribosome From Es | 2e-47 | ||
| 1p6g_K | 128 | Real Space Refined Coordinates Of The 30s Subunit F | 2e-47 | ||
| 3fih_K | 117 | Ternary Complex-Bound E.Coli 70s Ribosome. This Ent | 3e-45 | ||
| 2gy9_K | 116 | Structure Of The 30s Subunit Of A Pre-Translocation | 1e-44 | ||
| 3bbn_K | 140 | Homology Model For The Spinach Chloroplast 30s Subu | 4e-34 | ||
| 1pns_K | 119 | Crystal Structure Of A Streptomycin Dependent Ribos | 3e-27 | ||
| 1fjg_K | 129 | Structure Of The Thermus Thermophilus 30s Ribosomal | 6e-27 | ||
| 1i94_K | 128 | Crystal Structures Of The Small Ribosomal Subunit W | 7e-27 | ||
| 3j20_M | 137 | Promiscuous Behavior Of Proteins In Archaeal Riboso | 2e-17 | ||
| 2zkq_k | 151 | Structure Of A Mammalian Ribosomal 40s Subunit With | 1e-16 | ||
| 3iz6_K | 150 | Localization Of The Small Subunit Ribosomal Protein | 2e-16 | ||
| 3jyv_K | 125 | Structure Of The 40s Rrna And Proteins And PE TRNA | 6e-16 | ||
| 3izb_K | 137 | Localization Of The Small Subunit Ribosomal Protein | 3e-15 | ||
| 1s1h_K | 136 | Structure Of The Ribosomal 80s-Eef2-Sordarin Comple | 4e-15 | ||
| 3zey_H | 144 | High-resolution Cryo-electron Microscopy Structure | 3e-14 | ||
| 2xzm_K | 151 | Crystal Structure Of The Eukaryotic 40s Ribosomal S | 1e-12 | ||
| 3j0l_K | 140 | Core Of Mammalian 80s Pre-Ribosome In Complex With | 2e-12 |
| >pdb|1VS5|K Chain K, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 129 | Back alignment and structure |
|
| >pdb|1P6G|K Chain K, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 128 | Back alignment and structure |
| >pdb|3FIH|K Chain K, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 117 | Back alignment and structure |
| >pdb|2GY9|K Chain K, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 116 | Back alignment and structure |
| >pdb|3BBN|K Chain K, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 140 | Back alignment and structure |
| >pdb|1PNS|K Chain K, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 119 | Back alignment and structure |
| >pdb|1FJG|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 129 | Back alignment and structure |
| >pdb|1I94|K Chain K, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 128 | Back alignment and structure |
| >pdb|3J20|M Chain M, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (30s Ribosomal Subunit) Length = 137 | Back alignment and structure |
| >pdb|2ZKQ|KK Chain k, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 151 | Back alignment and structure |
| >pdb|3IZ6|K Chain K, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 150 | Back alignment and structure |
| >pdb|3JYV|K Chain K, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 125 | Back alignment and structure |
| >pdb|3IZB|K Chain K, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 137 | Back alignment and structure |
| >pdb|1S1H|K Chain K, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 136 | Back alignment and structure |
| >pdb|3ZEY|H Chain H, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 144 | Back alignment and structure |
| >pdb|2XZM|K Chain K, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 151 | Back alignment and structure |
| >pdb|3J0L|K Chain K, Core Of Mammalian 80s Pre-Ribosome In Complex With Trnas Fitted To A 9.8a Cryo-Em Map: Classic Pre State 1 Length = 140 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| 3bbn_K | 140 | Ribosomal protein S11; small ribosomal subunit, sp | 5e-72 | |
| 3r8n_K | 117 | 30S ribosomal protein S11; protein biosynthesis, R | 7e-72 | |
| 2vqe_K | 129 | 30S ribosomal protein S11, 30S ribosomal protein S | 1e-69 | |
| 3u5c_O | 137 | RP59A, 40S ribosomal protein S14-A; translation, r | 8e-65 | |
| 2xzm_K | 151 | RPS14E; ribosome, translation; 3.93A {Tetrahymena | 5e-56 |
| >3bbn_K Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 140 | Back alignment and structure |
|---|
Score = 211 bits (538), Expect = 5e-72
Identities = 62/133 (46%), Positives = 93/133 (69%)
Query: 1 MAKVLNNTNARIRKKIKKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSR 60
+ N + + + I +GV H+ ASFNNTI+T+TD +G +SWAS+G+ F+G++
Sbjct: 8 IGSRRNGRISSRKSASARKIPKGVIHVQASFNNTIVTVTDVRGRVVSWASAGTCGFRGTK 67
Query: 61 KSTPFAAQVAAESAGKIAIEHGIKNLEVRIKGPGPGRESSVRALNNLGIKITQIEDVTPI 120
+ TPFAAQ AA +A + +E G++ EV IKGPG GR++++RA+ GI ++ + DVTP+
Sbjct: 68 RGTPFAAQTAAGNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPM 127
Query: 121 PHNGCRPSKRRRV 133
PHNGCRP K+RRV
Sbjct: 128 PHNGCRPPKKRRV 140
|
| >2vqe_K 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.55.4.1 PDB: 1gix_N* 1hnw_K* 1hnx_K* 1hnz_K* 1hr0_K 1ibk_K* 1ibl_K* 1ibm_K 1j5e_K 1jgo_N* 1jgp_N* 1jgq_N* 1ml5_N* 1n32_K* 1n33_K* 1n34_K 1n36_K 1xmo_K* 1xmq_K* 1xnq_K* ... Length = 129 | Back alignment and structure |
|---|
| >3u5c_O RP59A, 40S ribosomal protein S14-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_K 3o30_H 3o2z_H 3u5g_O 1s1h_K 3jyv_K* Length = 137 | Back alignment and structure |
|---|
| >2xzm_K RPS14E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_K 3j0o_K 3j0l_K 2zkq_k 3iz6_K 3jyv_K* Length = 151 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| 3r8n_K | 117 | 30S ribosomal protein S11; protein biosynthesis, R | 100.0 | |
| 2vqe_K | 129 | 30S ribosomal protein S11, 30S ribosomal protein S | 100.0 | |
| 3bbn_K | 140 | Ribosomal protein S11; small ribosomal subunit, sp | 100.0 | |
| 3j20_M | 137 | 30S ribosomal protein S11P; archaea, archaeal, KIN | 100.0 | |
| 3u5c_O | 137 | RP59A, 40S ribosomal protein S14-A; translation, r | 100.0 | |
| 2xzm_K | 151 | RPS14E; ribosome, translation; 3.93A {Tetrahymena | 100.0 | |
| 3v2d_S | 112 | 50S ribosomal protein L18; ribosome associated inh | 97.69 | |
| 3r8s_O | 116 | 50S ribosomal protein L18; protein biosynthesis, R | 97.62 | |
| 1ovy_A | 120 | 50S ribosomal protein L18; ribosome; NMR {Geobacil | 97.49 | |
| 1vq8_N | 187 | 50S ribosomal protein L18P; ribosome 50S, protein- | 97.22 | |
| 2zjr_L | 114 | 50S ribosomal protein L18; ribosome, large ribosom | 97.17 | |
| 3j21_O | 203 | 50S ribosomal protein L18P; archaea, archaeal, KIN | 96.84 | |
| 3bbo_Q | 161 | Ribosomal protein L18; large ribosomal subunit, sp | 96.63 | |
| 2zkr_n | 297 | 60S ribosomal protein L5; protein-RNA complex, 60S | 96.07 | |
| 4a17_M | 301 | RPL5, 60S ribosomal protein L5; eukaryotic ribosom | 94.69 | |
| 3u5e_D | 297 | 60S ribosomal protein L5; translation, ribosome, r | 94.56 | |
| 3iz5_Q | 304 | 60S ribosomal protein L5 (L18P); eukaryotic riboso | 84.32 |
| >2vqe_K 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.55.4.1 PDB: 1gix_N* 1hnw_K* 1hnx_K* 1hnz_K* 1hr0_K 1ibk_K* 1ibl_K* 1ibm_K 1j5e_K 1jgo_N* 1jgp_N* 1jgq_N* 1ml5_N* 1n32_K* 1n33_K* 1n34_K 1n36_K 1xmo_K* 1xmq_K* 1xnq_K* ... | Back alignment and structure |
|---|
| >3bbn_K Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 | Back alignment and structure |
|---|
| >3j20_M 30S ribosomal protein S11P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3u5c_O RP59A, 40S ribosomal protein S14-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_K 3o30_H 3o2z_H 3u5g_O 1s1h_K 3jyv_K* | Back alignment and structure |
|---|
| >2xzm_K RPS14E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_K 3j0o_K 3j0l_K 2zkq_k 3iz6_K 3jyv_K* | Back alignment and structure |
|---|
| >3v2d_S 50S ribosomal protein L18; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_M 2hgj_R 2hgq_R 2hgu_R 1vsa_M 2j03_S 2jl6_S 2jl8_S 2v47_S 2v49_S 2wdi_S 2wdj_S 2wdl_S 2wdn_S 2wh2_S 2wh4_S 2wrj_S 2wrl_S 2wro_S 2wrr_S ... | Back alignment and structure |
|---|
| >3r8s_O 50S ribosomal protein L18; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 3fik_O 3j19_O 2wwq_O 3oat_O* 3oas_O* 3ofd_O 3ofc_O 3ofr_O* 3ofz_O* 3og0_O 3ofq_O 3r8t_O 3i1n_O 1p85_M 1p86_M 1vs8_O 1vs6_O 2aw4_O 2awb_O 1vt2_O ... | Back alignment and structure |
|---|
| >1ovy_A 50S ribosomal protein L18; ribosome; NMR {Geobacillus stearothermophilus} SCOP: c.55.4.1 | Back alignment and structure |
|---|
| >1vq8_N 50S ribosomal protein L18P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.55.4.1 PDB: 1vq4_N* 1vq5_N* 1vq6_N* 1vq7_N* 1s72_N* 1vq9_N* 1vqk_N* 1vql_N* 1vqm_N* 1vqn_N* 1vqo_N* 1vqp_N* 1yhq_N* 1yi2_N* 1yij_N* 1yit_N* 1yj9_N* 1yjn_N* 1yjw_N* 2otj_N* ... | Back alignment and structure |
|---|
| >2zjr_L 50S ribosomal protein L18; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: c.55.4.1 PDB: 1sm1_M* 2zjp_L* 2zjq_L 1nkw_M 3cf5_L* 3dll_L* 3pio_L* 3pip_L* 1nwy_M* 1nwx_M* 1xbp_M* 1pnu_M 1pny_M 1vor_P 1vou_P 1vow_P 1voy_P 1vp0_P | Back alignment and structure |
|---|
| >3j21_O 50S ribosomal protein L18P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bbo_Q Ribosomal protein L18; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} | Back alignment and structure |
|---|
| >2zkr_n 60S ribosomal protein L5; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >4a17_M RPL5, 60S ribosomal protein L5; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_M 4a1c_M 4a1e_M | Back alignment and structure |
|---|
| >3u5e_D 60S ribosomal protein L5; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_D 4b6a_D 3izc_Q 3izs_Q 3o58_E 3o5h_E 3jyw_E 1s1i_E | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 133 | ||||
| d2qalk1 | 117 | c.55.4.1 (K:12-128) Ribosomal protein S11 {Escheri | 4e-51 | |
| d2uubk1 | 119 | c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus | 9e-48 |
| >d2qalk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} Length = 117 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Translational machinery components family: Ribosomal protein L18 and S11 domain: Ribosomal protein S11 species: Escherichia coli [TaxId: 562]
Score = 156 bits (395), Expect = 4e-51
Identities = 81/117 (69%), Positives = 96/117 (82%)
Query: 17 KKHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSRKSTPFAAQVAAESAGK 76
+K +++GVAHIHASFNNTI+TITDR+G L WA++G F+GSRKSTPFAAQVAAE
Sbjct: 1 RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCAD 60
Query: 77 IAIEHGIKNLEVRIKGPGPGRESSVRALNNLGIKITQIEDVTPIPHNGCRPSKRRRV 133
E+GIKNLEV +KGPGPGRES++RALN G +IT I DVTPIPHNGCRP K+RRV
Sbjct: 61 AVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 117
|
| >d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} Length = 119 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| d2qalk1 | 117 | Ribosomal protein S11 {Escherichia coli [TaxId: 56 | 100.0 | |
| d2uubk1 | 119 | Ribosomal protein S11 {Thermus thermophilus [TaxId | 100.0 | |
| d1vqon1 | 186 | Ribosomal protein L18 (L18p) {Archaeon Haloarcula | 97.72 | |
| d1ovya_ | 97 | Ribosomal protein L18 (L18p) {Bacillus stearotherm | 97.53 | |
| d2gycm1 | 113 | Ribosomal protein L18 (L18p) {Escherichia coli [Ta | 97.04 | |
| d2j01s1 | 86 | Ribosomal protein L18 (L18p) {Thermus thermophilus | 96.28 | |
| d2zjrl1 | 104 | Ribosomal protein L18 (L18p) {Deinococcus radiodur | 93.97 |
| >d2qalk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Translational machinery components family: Ribosomal protein L18 and S11 domain: Ribosomal protein S11 species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.9e-53 Score=304.17 Aligned_cols=116 Identities=70% Similarity=1.137 Sum_probs=114.0
Q ss_pred ceeeeeEEEEEcccCCeEEEEEcCCCCeEEeeecceeeecCCCCCCHHHHHHHHHHHHHHHHHcCCcEEEEEEeCCCCCh
Q psy8857 18 KHITEGVAHIHASFNNTIITITDRKGCTLSWASSGSVNFKGSRKSTPFAAQVAAESAGKIAIEHGIKNLEVRIKGPGPGR 97 (133)
Q Consensus 18 ~~~~~~il~I~~t~NNTiitlTd~~G~~l~~~S~G~~gfKg~kk~t~~Aa~~aa~~~~~~~~~~gi~~v~v~~kG~G~Gr 97 (133)
+++..|++||++|+|||||||||++|++++|+|+|++||||++|+|||||+++++.++++++++|++.|+|+|+|+|+||
T Consensus 2 ~~~~~Gi~hI~~t~NNTiitlTD~~G~~~~~~S~G~~gfkg~~K~t~~Aa~~~a~~~~~~~~~~gi~~v~V~~kG~G~GR 81 (117)
T d2qalk1 2 KQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIKNLEVMVKGPGPGR 81 (117)
T ss_dssp CCCCEEEEEEECCSSCCEEEEEETTSCEEEEEETTTSSCCHHHHTSHHHHHHHHHHHHHHHGGGTCCEEEEEEECCSTTT
T ss_pred ccccceEEEEEecCCCEEEEEECCCCCEEEEEeccccccccccccchHHHHHHHHHHHHHHHHcCCcEEEEEEeCCCCch
Confidence 56788999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhhcCceEEEEEecCCCCCCCCCCCCCCCC
Q psy8857 98 ESSVRALNNLGIKITQIEDVTPIPHNGCRPSKRRRV 133 (133)
Q Consensus 98 ~~~lk~L~~~gl~I~~I~D~TpiphnGcR~kK~RRv 133 (133)
++++++|..+|++|.+|+|+||+|||||||||+|||
T Consensus 82 ~~air~l~~~gl~I~~I~D~TpiphnGcRp~K~RRv 117 (117)
T d2qalk1 82 ESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 117 (117)
T ss_dssp THHHHHHHHTTCEEEEEEECCCCCSSCSCCCCCCCC
T ss_pred HHHHHHHHhCCCEEEEEEECCCCCCCCCCCCCCCCC
Confidence 999999999999999999999999999999999997
|
| >d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vqon1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1ovya_ c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2gycm1 c.55.4.1 (M:3-115) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j01s1 c.55.4.1 (S:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2zjrl1 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|