Diaphorina citri psyllid: psy8859


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK
ccEEEECccccccccccEEECccccHHHHHHHHccccccccccccccccccEEEEcccccccccccHHHHHHHHcccccccccccccEEEECcccEEEEcccccccccc
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTIN***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2Fe-2S ferredoxin Ferredoxin are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.very confidentQ51383
2Fe-2S ferredoxin Ferredoxin are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. Although the function of this ferredoxin is unknown it is probable that it has a role as a cellular electron transfer protein. Involved in the in vivo assembly of the Fe-S clusters in a wide variety of iron-sulfur proteins.very confidentP0A9R6
2Fe-2S ferredoxin Ferredoxin are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.very confidentQ89A15

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022900 [BP]electron transport chainprobableGO:0044710, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0009055 [MF]electron carrier activityprobableGO:0003674
GO:0016020 [CC]membraneprobableGO:0005575
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0046232 [BP]carbazole catabolic processprobableGO:0044248, GO:0006805, GO:0034641, GO:0006807, GO:0070887, GO:0018884, GO:0042178, GO:1901360, GO:1901361, GO:1901575, GO:0071704, GO:0044699, GO:0009987, GO:0006725, GO:0051716, GO:0046700, GO:0008150, GO:0008152, GO:0042221, GO:0009056, GO:0046483, GO:1901564, GO:0044270, GO:0050896, GO:0009410, GO:0044237, GO:0071466, GO:0019439, GO:0044763, GO:1901565
GO:0051537 [MF]2 iron, 2 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AH7, chain A
Confidence level:very confident
Coverage over the Query: 1-108
View the alignment between query and template
View the model in PyMOL