Psyllid ID: psy8859

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK
ccEEEEEccccccccccEEEEccccHHHHHHHHccccccccccccccccccEEEEcccccccccccHHHHHHHHcccccccccccccEEEEEcccEEEEcccccccccc
ccEEEEccEcccEcccEEEEcccccEHHHHHHcccccccccccccccccccEEEEEEcHHHcccccHHHHHHHcccccccccEEEccccEcccccEEEEcccccccccc
mpqvivlphpvlcedgaifnensGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAwgleensrLSCQVIlgssdltieiprytinqvk
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVIlgssdltieiprytinqvk
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK
***VIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTI****
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTIN***
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTIN***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q51383112 2Fe-2S ferredoxin OS=Pseu yes N/A 0.990 0.964 0.583 1e-35
P0A9R6111 2Fe-2S ferredoxin OS=Shig yes N/A 1.0 0.981 0.587 6e-35
P0A9R4111 2Fe-2S ferredoxin OS=Esch N/A N/A 1.0 0.981 0.587 6e-35
P0A9R5111 2Fe-2S ferredoxin OS=Esch N/A N/A 1.0 0.981 0.587 6e-35
P44428113 2Fe-2S ferredoxin OS=Haem yes N/A 0.990 0.955 0.490 7e-28
O51882111 2Fe-2S ferredoxin OS=Buch yes N/A 0.990 0.972 0.509 3e-27
Q89A15107 2Fe-2S ferredoxin OS=Buch yes N/A 0.981 1.0 0.514 4e-27
P57661111 2Fe-2S ferredoxin OS=Buch yes N/A 0.972 0.954 0.471 3e-25
Q92J08112 2Fe-2S ferredoxin OS=Rick yes N/A 0.761 0.741 0.465 3e-13
Q4UKL2112 2Fe-2S ferredoxin OS=Rick yes N/A 0.761 0.741 0.453 4e-13
>sp|Q51383|FER_PSEAE 2Fe-2S ferredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fdx PE=3 SV=2 Back     alignment and function desciption
 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (77%)

Query: 1   MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFN 60
           MPQ+++LPH   C +GA+F    G ++ DA L+N I IEHACEKSCAC TCHVI+REG +
Sbjct: 1   MPQIVILPHADHCPEGAVFEAKPGETILDAALRNGIEIEHACEKSCACTTCHVIVREGLD 60

Query: 61  EINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQV 108
            +  ++E+E+DML+KAWGLE +SRLSCQ ++   DL +EIP+YTINQV
Sbjct: 61  SMEPSDELEDDMLDKAWGLEPDSRLSCQAVVADEDLVVEIPKYTINQV 108
Ferredoxin are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) (taxid: 208964)
>sp|P0A9R6|FER_SHIFL 2Fe-2S ferredoxin OS=Shigella flexneri GN=fdx PE=3 SV=2 Back     alignment and function description
>sp|P0A9R4|FER_ECOLI 2Fe-2S ferredoxin OS=Escherichia coli (strain K12) GN=fdx PE=1 SV=2 Back     alignment and function description
>sp|P0A9R5|FER_ECO57 2Fe-2S ferredoxin OS=Escherichia coli O157:H7 GN=fdx PE=3 SV=2 Back     alignment and function description
>sp|P44428|FER_HAEIN 2Fe-2S ferredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fdx PE=3 SV=2 Back     alignment and function description
>sp|O51882|FER_BUCAP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fdx PE=3 SV=1 Back     alignment and function description
>sp|Q89A15|FER_BUCBP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fdx PE=3 SV=1 Back     alignment and function description
>sp|P57661|FER_BUCAI 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fdx PE=3 SV=1 Back     alignment and function description
>sp|Q92J08|FER2_RICCN 2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
94309975112 ferredoxin, 2Fe-2S type [Cupriavidus met 1.0 0.973 0.678 1e-38
430808895112 (2Fe-2S) ferredoxin [Cupriavidus sp. HMR 1.0 0.973 0.669 4e-38
339325251112 2Fe-2S ferredoxin [Cupriavidus necator N 1.0 0.973 0.669 7e-38
302877890111 ferredoxin, 2Fe-2S type, ISC system [Gal 1.0 0.981 0.669 1e-37
73540766112 ferredoxin, 2Fe-2S type [Ralstonia eutro 1.0 0.973 0.651 1e-37
415905208112 Ferredoxin, 2Fe-2S type [Herbaspirillum 1.0 0.973 0.623 3e-37
113867184112 ferredoxin, 2Fe-2S [Ralstonia eutropha H 1.0 0.973 0.651 9e-37
291614708114 ferredoxin, 2Fe-2S type, ISC system [Sid 1.0 0.956 0.660 1e-36
300312438112 ferredoxin [2Fe-2S]-type protein [Herbas 0.981 0.955 0.626 1e-36
193222371112 2Fe-2S ferredoxin [Herminiimonas arsenic 0.981 0.955 0.654 1e-36
>gi|94309975|ref|YP_583185.1| ferredoxin, 2Fe-2S type [Cupriavidus metallidurans CH34] gi|93353827|gb|ABF07916.1| ferredoxin, 2Fe-2S type [Cupriavidus metallidurans CH34] Back     alignment and taxonomy information
 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/109 (67%), Positives = 87/109 (79%)

Query: 1   MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFN 60
           MPQ+IVLPH  LC +GA+F  N+G S+CDALL N I IEHACEKSCAC TCHVI+REGFN
Sbjct: 1   MPQIIVLPHVELCPEGAVFEANTGTSVCDALLANGIEIEHACEKSCACTTCHVIVREGFN 60

Query: 61  EINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK 109
            +  A E EED+L+KAWGLE NSRLSCQ ++   DLT+EIP+YTIN  K
Sbjct: 61  SLEDAEEKEEDLLDKAWGLEPNSRLSCQALVADDDLTVEIPKYTINHAK 109

Source: Cupriavidus metallidurans CH34

Species: Cupriavidus metallidurans

Genus: Cupriavidus

Family: Burkholderiaceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|430808895|ref|ZP_19436010.1| (2Fe-2S) ferredoxin [Cupriavidus sp. HMR-1] gi|429498658|gb|EKZ97162.1| (2Fe-2S) ferredoxin [Cupriavidus sp. HMR-1] Back     alignment and taxonomy information
>gi|339325251|ref|YP_004684944.1| 2Fe-2S ferredoxin [Cupriavidus necator N-1] gi|338165408|gb|AEI76463.1| 2Fe-2S ferredoxin Fdx [Cupriavidus necator N-1] Back     alignment and taxonomy information
>gi|302877890|ref|YP_003846454.1| ferredoxin, 2Fe-2S type, ISC system [Gallionella capsiferriformans ES-2] gi|302580679|gb|ADL54690.1| ferredoxin, 2Fe-2S type, ISC system [Gallionella capsiferriformans ES-2] Back     alignment and taxonomy information
>gi|73540766|ref|YP_295286.1| ferredoxin, 2Fe-2S type [Ralstonia eutropha JMP134] gi|72118179|gb|AAZ60442.1| Ferredoxin, 2Fe-2S type [Ralstonia eutropha JMP134] Back     alignment and taxonomy information
>gi|415905208|ref|ZP_11552477.1| Ferredoxin, 2Fe-2S type [Herbaspirillum frisingense GSF30] gi|407763396|gb|EKF72070.1| Ferredoxin, 2Fe-2S type [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|113867184|ref|YP_725673.1| ferredoxin, 2Fe-2S [Ralstonia eutropha H16] gi|113525960|emb|CAJ92305.1| Ferredoxin, 2Fe-2S [Ralstonia eutropha H16] Back     alignment and taxonomy information
>gi|291614708|ref|YP_003524865.1| ferredoxin, 2Fe-2S type, ISC system [Sideroxydans lithotrophicus ES-1] gi|291584820|gb|ADE12478.1| ferredoxin, 2Fe-2S type, ISC system [Sideroxydans lithotrophicus ES-1] Back     alignment and taxonomy information
>gi|300312438|ref|YP_003776530.1| ferredoxin [2Fe-2S]-type protein [Herbaspirillum seropedicae SmR1] gi|300075223|gb|ADJ64622.1| ferredoxin [2Fe-2S]-type protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|193222371|emb|CAL62368.1| 2Fe-2S ferredoxin [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
UNIPROTKB|P0A9R4111 fdx "reduced ferredoxin" [Esch 1.0 0.981 0.587 5.8e-34
TIGR_CMR|VC_0753139 VC_0753 "ferredoxin" [Vibrio c 0.972 0.762 0.575 4.1e-33
TIGR_CMR|SO_2269111 SO_2269 "ferredoxin, 2Fe-2S" [ 0.990 0.972 0.592 5.2e-33
TIGR_CMR|CPS_1137112 CPS_1137 "ferredoxin, 2Fe-2S" 0.990 0.964 0.583 8.5e-33
UNIPROTKB|Q4K6U3113 fdx "Ferredoxin, 2Fe-2S type, 0.972 0.938 0.566 8.8e-31
TAIR|locus:2115939197 MFDX1 "mitochondrial ferredoxi 0.761 0.421 0.448 9.1e-13
TAIR|locus:2127358197 MFDX2 "MITOCHONDRIAL FERREDOXI 0.761 0.421 0.413 1.3e-11
FB|FBgn0011769172 Fdxh "Ferredoxin" [Drosophila 0.678 0.430 0.415 1.7e-11
TIGR_CMR|NSE_0297111 NSE_0297 "iron-sulfur cluster 0.779 0.765 0.386 1.7e-11
UNIPROTKB|F1N980171 FDX1 "Adrenodoxin, mitochondri 0.715 0.456 0.397 2.2e-11
UNIPROTKB|P0A9R4 fdx "reduced ferredoxin" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 369 (135.0 bits), Expect = 5.8e-34, P = 5.8e-34
 Identities = 64/109 (58%), Positives = 83/109 (76%)

Query:     1 MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFN 60
             MP++++LPH  LC DGA+   NSG ++ DA L+N I IEHACEKSCAC TCH I+REGF+
Sbjct:     1 MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFD 60

Query:    61 EINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK 109
              + +++E E+DML+KAWGLE  SRLSCQ  +   DL +EIPRYTIN  +
Sbjct:    61 SLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAR 109
GO:0009055 "electron carrier activity" evidence=IEA
GO:0022900 "electron transport chain" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
TIGR_CMR|VC_0753 VC_0753 "ferredoxin" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2269 SO_2269 "ferredoxin, 2Fe-2S" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1137 CPS_1137 "ferredoxin, 2Fe-2S" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K6U3 fdx "Ferredoxin, 2Fe-2S type, ISC system" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
TAIR|locus:2115939 MFDX1 "mitochondrial ferredoxin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127358 MFDX2 "MITOCHONDRIAL FERREDOXIN 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0011769 Fdxh "Ferredoxin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0297 NSE_0297 "iron-sulfur cluster binding protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
UNIPROTKB|F1N980 FDX1 "Adrenodoxin, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q1RJ69FER2_RICBRNo assigned EC number0.47670.76140.7477yesN/A
P0A9R6FER_SHIFLNo assigned EC number0.58711.00.9819yesN/A
P0A9R5FER_ECO57No assigned EC number0.58711.00.9819N/AN/A
P37098FER2_CAUCRNo assigned EC number0.31770.88070.9056yesN/A
Q9ZDW6FER2_RICPRNo assigned EC number0.44180.76140.7410yesN/A
P0A9R4FER_ECOLINo assigned EC number0.58711.00.9819N/AN/A
Q9AKH1FER2_RICRINo assigned EC number0.45340.76140.7410yesN/A
Q8SV19ADRX_ENCCUNo assigned EC number0.34880.76140.6484yesN/A
Q92J08FER2_RICCNNo assigned EC number0.46510.76140.7410yesN/A
Q4UKL2FER2_RICFENo assigned EC number0.45340.76140.7410yesN/A
O51882FER_BUCAPNo assigned EC number0.50920.99080.9729yesN/A
P44428FER_HAEINNo assigned EC number0.49070.99080.9557yesN/A
Q89A15FER_BUCBPNo assigned EC number0.51400.98161.0yesN/A
Q51383FER_PSEAENo assigned EC number0.58330.99080.9642yesN/A
Q9AKM6FER2_RICMONo assigned EC number0.45340.76140.7410yesN/A
P59799FER5_AQUAENo assigned EC number0.34310.87150.9895yesN/A
Q9AKC4FER2_RICTYNo assigned EC number0.44180.76140.7094yesN/A
P57661FER_BUCAINo assigned EC number0.47160.97240.9549yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 2e-49
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 3e-21
PLN02593117 PLN02593, PLN02593, adrenodoxin-like ferredoxin pr 2e-19
PTZ00490143 PTZ00490, PTZ00490, Ferredoxin superfamily; Provis 3e-15
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 9e-10
COG2871 410 COG2871, NqrF, Na+-transporting NADH:ubiquinone ox 4e-08
PRK05464 409 PRK05464, PRK05464, Na(+)-translocating NADH-quino 7e-08
TIGR01941 405 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N 2e-07
COG3894 614 COG3894, COG3894, Uncharacterized metal-binding pr 8e-05
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 1e-04
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information 
 Score =  152 bits (385), Expect = 2e-49
 Identities = 60/108 (55%), Positives = 79/108 (73%)

Query: 2   PQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNE 61
           P+++ LPH  LC +GA+     G ++ D  L N I IEHACEKSCAC TCH I+REGF+ 
Sbjct: 1   PKIVFLPHEDLCPEGAVVEAKPGETILDVALDNGIEIEHACEKSCACTTCHCIVREGFDS 60

Query: 62  INKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK 109
           + +A+E EEDML+KAWGLE +SRLSCQ ++   DL +EIP+YTIN  +
Sbjct: 61  LEEASEQEEDMLDKAWGLEPDSRLSCQAVVADEDLVVEIPKYTINHAR 108

This family consists of proteobacterial ferredoxins associated with and essential to the ISC system of 2Fe-2S cluster assembly. This family is closely related to (but excludes) eukaryotic (mitochondrial) adrenodoxins, which are ferredoxins involved in electron transfer to P450 cytochromes [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]. Length = 110
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|178203 PLN02593, PLN02593, adrenodoxin-like ferredoxin protein Back     alignment and domain information
>gnl|CDD|185668 PTZ00490, PTZ00490, Ferredoxin superfamily; Provisional Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|225426 COG2871, NqrF, Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235481 PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>gnl|CDD|226410 COG3894, COG3894, Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.96
PLN02593117 adrenodoxin-like ferredoxin protein 99.96
PTZ00490143 Ferredoxin superfamily; Provisional 99.94
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.92
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.92
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.91
CHL0013499 petF ferredoxin; Validated 99.9
PLN03136148 Ferredoxin; Provisional 99.89
KOG3309|consensus159 99.88
PTZ00038191 ferredoxin; Provisional 99.87
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.84
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.84
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.83
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.82
PRK05713 312 hypothetical protein; Provisional 99.82
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.8
COG3894 614 Uncharacterized metal-binding protein [General fun 99.79
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.77
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.74
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.74
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.74
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 99.43
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 99.35
PRK08166 847 NADH dehydrogenase subunit G; Validated 99.29
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 99.09
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.91
PRK09130 687 NADH dehydrogenase subunit G; Validated 98.9
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 98.9
PRK08493 819 NADH dehydrogenase subunit G; Validated 98.79
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 98.71
PRK07860 797 NADH dehydrogenase subunit G; Validated 98.69
PRK09129 776 NADH dehydrogenase subunit G; Validated 98.67
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 98.56
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 98.34
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 98.16
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 98.1
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 98.03
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 98.02
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 97.98
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 97.88
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 97.82
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 97.61
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 97.61
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 97.6
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 97.49
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 97.46
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 97.34
KOG2282|consensus 708 97.25
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 97.22
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 97.13
PRK09800 956 putative hypoxanthine oxidase; Provisional 97.11
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 96.96
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 96.95
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 96.91
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 96.79
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.75
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 96.65
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 96.31
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 96.06
PLN00192 1344 aldehyde oxidase 95.89
COG4630 493 XdhA Xanthine dehydrogenase, iron-sulfur cluster a 93.42
PLN02906 1319 xanthine dehydrogenase 90.05
KOG0430|consensus 1257 89.3
PRK0565966 sulfur carrier protein ThiS; Validated 89.24
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 88.76
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 87.12
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 85.83
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 85.77
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 85.23
PF1041840 DHODB_Fe-S_bind: Iron-sulfur cluster binding domai 85.04
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 84.99
smart0045570 RBD Raf-like Ras-binding domain. 83.03
PRK0744070 hypothetical protein; Provisional 82.09
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 82.0
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 81.91
PRK0586365 sulfur carrier protein ThiS; Provisional 81.15
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 80.33
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information 
Probab=99.96  E-value=5.9e-29  Score=161.14  Aligned_cols=106  Identities=57%  Similarity=1.085  Sum_probs=94.2

Q ss_pred             CEEEEEeCCccCCCCcEEEeCCCChHHHHHHhCCCCccccCCCCCCCCccEEEecCCcccCCCCCHHHHhhchhcCCCCC
Q psy8859           2 PQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEE   81 (109)
Q Consensus         2 ~~V~~~~~~~~~~~g~~i~~~~g~tLl~a~~~~gi~i~~~C~G~G~CgtC~v~v~~g~~~l~~~~~~E~~~L~~~~~~~~   81 (109)
                      |+|.|+++..+.|.|++|++.+|+|||++++++|+++++.|+|.|.||+|+|+|.+|...+++.+..|.+.|+...+..+
T Consensus         1 ~~~~~~~~~~~~p~~~~~~~~~g~tLL~a~~~~gi~i~~~CgG~G~CgtC~v~V~~G~~~~~~~~~~e~~~L~~~~~~~~   80 (110)
T TIGR02007         1 PKIVFLPHEDLCPEGAVVEAKPGETILDVALDNGIEIEHACEKSCACTTCHCIVREGFDSLEEASEQEEDMLDKAWGLEP   80 (110)
T ss_pred             CeEEEEeCcccCCCCeEEEECCCChHHHHHHHcCCCccccCCCCceeCCCEEEEeeccccCCCCCHHHHHHHhhccCCCC
Confidence            57888877777799999999999999999999999999999999999999999999987788888888888874446789


Q ss_pred             CeEEeeeeEeeCCCEEEEeCCCCccc
Q psy8859          82 NSRLSCQVILGSSDLTIEIPRYTINQ  107 (109)
Q Consensus        82 ~~rLaCq~~~~~~di~v~~~~~~~~~  107 (109)
                      +||||||+.+.++|++|++|..+.+.
T Consensus        81 ~~RLaCq~~~~~~dl~v~~~~~~~~~  106 (110)
T TIGR02007        81 DSRLSCQAVVADEDLVVEIPKYTINH  106 (110)
T ss_pred             CcEEeeeEEEcCCCEEEEECchhhhh
Confidence            99999999998569999999876654

This family consists of proteobacterial ferredoxins associated with and essential to the ISC system of 2Fe-2S cluster assembly. This family is closely related to (but excludes) eukaryotic (mitochondrial) adrenodoxins, which are ferredoxins involved in electron transfer to P450 cytochromes.
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>KOG3309|consensus Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG2282|consensus Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02906 xanthine dehydrogenase Back     alignment and domain information
>KOG0430|consensus Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
1i7h_A111 Crystal Sturcuture Of Fdx Length = 111 5e-36
3ah7_A113 Crystal Structure Of The Isc-Like [2fe-2s] Ferredox 1e-20
2wlb_A103 Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schi 4e-13
3p1m_A132 Crystal Structure Of Human Ferredoxin-1 (Fdx1) In C 7e-10
3n9z_C123 Crystal Structure Of Human Cyp11a1 In Complex With 7e-10
3n9y_C114 Crystal Structure Of Human Cyp11a1 In Complex With 8e-10
1cje_A127 Adrenodoxin From Bovine Length = 127 1e-09
1l6u_A128 Nmr Structure Of Oxidized Adrenodoxin Length = 128 1e-09
3hui_A126 Crystal Structure Of The Mutant A105r Of [2fe-2s] F 1e-09
1l6v_A128 Structure Of Reduced Bovine Adrenodoxin Length = 12 1e-09
1e6e_B128 Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHO 1e-09
1ayf_A105 Bovine Adrenodoxin (oxidized) Length = 105 1e-09
2bt6_A108 Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 1e-09
2jqr_B105 Solution Model Of Crosslinked Complex Of Cytochrome 2e-09
2y5c_A109 Structure Of Human Ferredoxin 2 (Fdx2)in Complex Wi 4e-09
1oqq_A106 Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOX 2e-08
1gpx_A106 C85s Gapdx, Nmr, 20 Structures Length = 106 9e-08
3na0_C68 Crystal Structure Of Human Cyp11a1 In Complex With 9e-08
1oqr_A106 Crystal Structure Of C73s Mutant Of Putidaredoxin, 2e-07
1r7s_A106 Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Lengt 2e-07
1put_A106 An Nmr-Derived Model For The Solution Structure Of 5e-07
1pdx_A106 Putidaredoxin Length = 106 5e-07
1e9m_A106 Ferredoxin Vi From Rhodobacter Capsulatus Length = 1e-04
1b9r_A105 Terpredoxin From Pseudomonas Sp Length = 105 2e-04
3lxf_A104 Crystal Structure Of [2fe-2s] Ferredoxin Arx From N 4e-04
>pdb|1I7H|A Chain A, Crystal Sturcuture Of Fdx Length = 111 Back     alignment and structure 
Iteration: 1

 Score =  145 bits (367), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 83/109 (76%)
Query: 1   MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFN 60
           MP++++LPH  LC DGA+   NSG ++ DA L+N I IEHACEKSCAC TCH I+REGF+
Sbjct: 1   MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFD 60
Query: 61  EINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK 109
            + +++E E+DML+KAWGLE  SRLSCQ  +   DL +EIPRYTIN  +
Sbjct: 61  SLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAR 109
>pdb|3AH7|A Chain A, Crystal Structure Of The Isc-Like [2fe-2s] Ferredoxin (Fdxb) From Pseudomonas Putida Jcm 20004 Length = 113 Back     alignment and structure
>pdb|2WLB|A Chain A, Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schizosaccharomyces Pombe Mitochondria Length = 103 Back     alignment and structure
>pdb|3P1M|A Chain A, Crystal Structure Of Human Ferredoxin-1 (Fdx1) In Complex With Iron- Sulfur Cluster Length = 132 Back     alignment and structure
>pdb|3N9Z|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 22- Hydroxycholesterol Length = 123 Back     alignment and structure
>pdb|3N9Y|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 114 Back     alignment and structure
>pdb|1CJE|A Chain A, Adrenodoxin From Bovine Length = 127 Back     alignment and structure
>pdb|1L6U|A Chain A, Nmr Structure Of Oxidized Adrenodoxin Length = 128 Back     alignment and structure
>pdb|3HUI|A Chain A, Crystal Structure Of The Mutant A105r Of [2fe-2s] Ferredoxin In The Class I Cyp199a2 System From Rhodopseudomonas Palustris Length = 126 Back     alignment and structure
>pdb|1L6V|A Chain A, Structure Of Reduced Bovine Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1E6E|B Chain B, Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHONDRIAL P450 Systems Length = 128 Back     alignment and structure
>pdb|1AYF|A Chain A, Bovine Adrenodoxin (oxidized) Length = 105 Back     alignment and structure
>pdb|2BT6|A Chain A, Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 108 Back     alignment and structure
>pdb|2JQR|B Chain B, Solution Model Of Crosslinked Complex Of Cytochrome C And Adrenodoxin Length = 105 Back     alignment and structure
>pdb|2Y5C|A Chain A, Structure Of Human Ferredoxin 2 (Fdx2)in Complex With 2fe2s Cluster Length = 109 Back     alignment and structure
>pdb|1OQQ|A Chain A, Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOXIN, A [2FE-2s] Ferredoxin From Pseudomonas Putida, At 1.47a Resolution Length = 106 Back     alignment and structure
>pdb|1GPX|A Chain A, C85s Gapdx, Nmr, 20 Structures Length = 106 Back     alignment and structure
>pdb|3NA0|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 68 Back     alignment and structure
>pdb|1OQR|A Chain A, Crystal Structure Of C73s Mutant Of Putidaredoxin, A [2fe- 2s] Ferredoxin From Pseudomonas Putida, At 1.65a Resolution Length = 106 Back     alignment and structure
>pdb|1R7S|A Chain A, Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Length = 106 Back     alignment and structure
>pdb|1PUT|A Chain A, An Nmr-Derived Model For The Solution Structure Of Oxidized Putidaredoxin, A 2fe, 2-S Ferredoxin From Pseudomonas Length = 106 Back     alignment and structure
>pdb|1PDX|A Chain A, Putidaredoxin Length = 106 Back     alignment and structure
>pdb|1E9M|A Chain A, Ferredoxin Vi From Rhodobacter Capsulatus Length = 106 Back     alignment and structure
>pdb|1B9R|A Chain A, Terpredoxin From Pseudomonas Sp Length = 105 Back     alignment and structure
>pdb|3LXF|A Chain A, Crystal Structure Of [2fe-2s] Ferredoxin Arx From Novosphingobium Aromaticivorans Length = 104 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 1e-52
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 1e-51
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 1e-31
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 3e-31
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 2e-30
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 1e-28
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 3e-24
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 6e-22
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 1e-21
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 1e-21
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 7e-21
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 5e-18
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 9e-06
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 2e-05
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
 Score =  159 bits (405), Expect = 1e-52
 Identities = 64/109 (58%), Positives = 83/109 (76%)

Query: 1   MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFN 60
           MP++++LPH  LC DGA+   NSG ++ DA L+N I IEHACEKSCAC TCH I+REGF+
Sbjct: 1   MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFD 60

Query: 61  EINKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK 109
            + +++E E+DML+KAWGLE  SRLSCQ  +   DL +EIPRYTIN  +
Sbjct: 61  SLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAR 109
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 100.0
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.97
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.97
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.96
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.96
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.96
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.96
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.96
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.95
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.95
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.95
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.92
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.92
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.92
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.91
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.91
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.91
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.91
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.9
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.9
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.87
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.87
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.87
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.81
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 99.19
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 98.97
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.74
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 98.58
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 98.43
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 98.4
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 98.39
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 98.38
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 98.31
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 97.99
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 97.81
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 97.65
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 97.62
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 97.61
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 97.55
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.26
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 97.17
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.79
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 96.03
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 94.75
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 84.39
3hvz_A78 Uncharacterized protein; alpha-beta protein, struc 81.42
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 81.28
1wwt_A88 Threonyl-tRNA synthetase, cytoplasmic; TGS domain, 80.06
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
Probab=100.00  E-value=8.8e-33  Score=178.35  Aligned_cols=108  Identities=46%  Similarity=0.896  Sum_probs=97.1

Q ss_pred             CCEEEEEeCCccCCCCcEEEeCCCChHHHHHHhCCCCccccCCCCCCCCccEEEecCCcccCCCCCHHHHhhchhcCCCC
Q psy8859           1 MPQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLE   80 (109)
Q Consensus         1 M~~V~~~~~~~~~~~g~~i~~~~g~tLl~a~~~~gi~i~~~C~G~G~CgtC~v~v~~g~~~l~~~~~~E~~~L~~~~~~~   80 (109)
                      ||+|||.+++++.++|++|++++|+|||++|+++||++++.|+|.|.||+|+|+|.+|...++++++.|+.+|+...++.
T Consensus         1 M~~vt~~~~~g~~~~~~~v~~~~g~tlL~aa~~~Gi~i~~~C~g~G~CgtC~v~v~~G~~~~~~~~~~e~~~L~~~~~~~   80 (113)
T 3ah7_A            1 MPLVTFLPHEKFCPEGLTVEVKPGTNILELAHDHHIEMESACGGVKACTTCHCIVRKGFDSLEEADELEEDMLDKAWGLE   80 (113)
T ss_dssp             CCEEEECCBTTTBTTCEEEECCTTCBHHHHHHHTTCCCCCTTCSSSSCSTTEEEEEESGGGSCCCCHHHHHHHTTSTTCC
T ss_pred             CCEEEEEcCCCcCCCCeEEEECCCCcHHHHHHHcCCCCCcCCCCCCCcCCCEEEEcCCcccCCCCCHHHHHhhhcccccC
Confidence            99999997666666889999999999999999999999999998899999999999998778888999999998433788


Q ss_pred             CCeEEeeeeEeeCCCEEEEeCCCCcccc
Q psy8859          81 ENSRLSCQVILGSSDLTIEIPRYTINQV  108 (109)
Q Consensus        81 ~~~rLaCq~~~~~~di~v~~~~~~~~~~  108 (109)
                      +++|||||+++.++|++|++|..+.+.+
T Consensus        81 ~g~rLaCq~~~~~~dl~v~~~~~~~~~~  108 (113)
T 3ah7_A           81 AQSRLGCQVFVADEDLTIEIPKYSLNHA  108 (113)
T ss_dssp             TTEEEGGGCBCCSSCEEEECCSCCCCCC
T ss_pred             CCcEEeeeCEEeCCCEEEEECchhhhhh
Confidence            9999999999975699999998887765
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 7e-35
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 2e-17
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 4e-16
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 6e-16
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 3e-15
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 3e-14
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 9e-10
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 1e-08
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 2e-08
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 7e-08
d2piaa398 d.15.4.2 (A:224-321) Phthalate dioxygenase reducta 3e-07
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 1e-05
d1czpa_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 1e-04
d1frra_95 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 2e-04
d1frda_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 3e-04
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin-like ferredoxin
species: Escherichia coli [TaxId: 562]

 Score =  113 bits (284), Expect = 7e-35
 Identities = 63/108 (58%), Positives = 82/108 (75%)

Query: 2   PQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNE 61
           P++++LPH  LC DGA+   NSG ++ DA L+N I IEHACEKSCAC TCH I+REGF+ 
Sbjct: 1   PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDS 60

Query: 62  INKANEVEEDMLNKAWGLEENSRLSCQVILGSSDLTIEIPRYTINQVK 109
           + +++E E+DML+KAWGLE  SRLSCQ  +   DL +EIPRYTIN  +
Sbjct: 61  LPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAR 108
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 98 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 95 Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 100.0
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.96
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.96
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.95
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.93
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.93
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.93
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.93
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.92
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.92
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.92
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.92
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.92
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.92
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.9
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.89
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.83
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 99.35
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.69
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.69
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.67
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 98.34
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.24
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.24
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 98.21
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 98.02
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 97.85
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 97.68
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 96.75
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 95.63
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 94.43
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 84.0
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin-like ferredoxin
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.5e-34  Score=183.56  Aligned_cols=108  Identities=58%  Similarity=1.093  Sum_probs=99.0

Q ss_pred             CEEEEEeCCccCCCCcEEEeCCCChHHHHHHhCCCCccccCCCCCCCCccEEEecCCcccCCCCCHHHHhhchhcCCCCC
Q psy8859           2 PQVIVLPHPVLCEDGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEE   81 (109)
Q Consensus         2 ~~V~~~~~~~~~~~g~~i~~~~g~tLl~a~~~~gi~i~~~C~G~G~CgtC~v~v~~g~~~l~~~~~~E~~~L~~~~~~~~   81 (109)
                      |||+|.++.-+.|+|++|++++|+|||++|+++||++++.|+|.|.||+|+|+|.+|+.++++++..|+.+|....+..+
T Consensus         1 pki~~~p~~~~~p~g~~v~~~~G~tLl~aa~~~gi~i~~~CgG~g~CgtC~v~v~~G~~~l~~~~~~E~~~l~~~~~~~~   80 (109)
T d1i7ha_           1 PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEP   80 (109)
T ss_dssp             CEEEECCBTTTBTTCEEEECCTTCBHHHHHHHTTCCCCCTTSSSSCCSTTEEEEEECGGGSCCCCHHHHHHHTTCTTCCT
T ss_pred             CeEEEecCcccCCCCcEEEeCCCCcHHHHHHHcCCCCCcCCCCcceeCCeEEEeecCccccCCCChHHhhhhhccccCCC
Confidence            78888776667799999999999999999999999999999989999999999999999999999999998875567889


Q ss_pred             CeEEeeeeEeeCCCEEEEeCCCCccccC
Q psy8859          82 NSRLSCQVILGSSDLTIEIPRYTINQVK  109 (109)
Q Consensus        82 ~~rLaCq~~~~~~di~v~~~~~~~~~~~  109 (109)
                      +||||||+++.++|++|++|+.+.|.++
T Consensus        81 ~~RLaCQ~~v~~~dl~V~lP~~t~~~~~  108 (109)
T d1i7ha_          81 ESRLSCQARVTDEDLVVEIPRYTINHAR  108 (109)
T ss_dssp             TEEETTTCBCCSSCEEEECCSCCCCTTC
T ss_pred             CeEEEEeeEECCCCEEEEeCccchhhcc
Confidence            9999999999856999999999999875
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure