Diaphorina citri psyllid: psy8891


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MCAKFLGDPTKVVSGSCDRTLKIWDLRSTETKFAGSSCNDLVTYDGAGTTIISGHFDKKVRFWDFRAEEKVRDIELHGKITSLDLSKGTETKFAGSSCNDLVTYDGAGTTIISGHFDKKVRFWDFRAEEKVRDIELHGKITSLDLSKGKYYFVFAEGFKVQCDFTRAVFVVDDDYVAVGSIDGNIYVWDCNTEQVEAVLKDMH
cEEEECccccEEEEECccccEEEEEcccccEEEECcccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEEccccEEEEEEcccccEEEECccccEEEEECccccEEEECcccccEEEEEcccccEEEEEcccccEEEEEEccccEEEEEEcccCEEccEEEEEEcccccEEEEECccccEEEEEccccEEEccccccc
MCAKFLGDPTKVVSGSCDRTLKIWDLRSTETKFAGSSCNDLVTYDGAGTTIISGHFDKKVRFWDFRAEEKVRDIELHGKITSLDLSKGTETKFAGSSCNDLVTYDGAGTTIISGHFDKKVRFWDFRAEEKVRDIELHGKITSLDLSKGKYYFVFAEGFKVQCDFTRAVFVVDDDYVAVGSIDGNIYVWDCNTEQVEAVL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCAKFLGDPTKVVSGSCDRTLKIWDLRSTETKFAGSSCNDLVTYDGAGTTIISGHFDKKVRFWDFRAEEKVRDIELHGKITSLDLSKGTETKFAGSSCNDLVTYDGAGTTIISGHFDKKVRFWDFRAEEKVRDIELHGKITSLDLSKGKYYFVFAEGFKVQCDFTRAVFVVDDDYVAVGSIDGNIYVWDCNTEQVEAVLKDMH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005834 [CC]heterotrimeric G-protein complexprobableGO:0043234, GO:0019897, GO:0032991, GO:0016020, GO:0044464, GO:0009898, GO:0019898, GO:0005575, GO:0071944, GO:0005623, GO:0005886, GO:0044424, GO:0044425, GO:0005622, GO:0044459, GO:0031234
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0000421 [CC]autophagic vacuole membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043229, GO:0005773, GO:0016020, GO:0044464, GO:0005776, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 1-202
View the alignment between query and template
View the model in PyMOL