Diaphorina citri psyllid: psy8908


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MTENVENSLSNKMTSLSTSTSSFEPMISHDPRLNELATNMFKKTADYLIGELSSTQADYEVLEKMNNATITKYSDMKQITVNISFSSARVPAYKQLIPQLEQIDQIYDSVLKLEQAAYKLDHYAKRLEAKFKQLEKQ
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
***********************************LATNMFKKTADYLIGELSSTQADYEVLEKMNNATITKYSDMKQITVNISFSSARVPAYKQLIPQLEQIDQIYDSVLKLEQAAYKLDHYAKRLEAKFK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTENVENSLSNKMTSLSTSTSSFEPMISHDPRLNELATNMFKKTADYLIGELSSTQADYEVLEKMNNATITKYSDMKQITVNISFSSARVPAYKQLIPQLEQIDQIYDSVLKLEQAAYKLDHYAKRLEAKFKQLEKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Biogenesis of lysosome-related organelles complex-1 subunit 2 May play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking (By similarity). May be a mediator in the mechanisms of neuropathic pain.confidentQ32WR5
Biogenesis of lysosome-related organelles complex 1 subunit 2 May play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking.confidentQ9CWG9
Biogenesis of lysosome-related organelles complex 1 subunit 2 May play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking.confidentQ6QNY1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031083 [CC]BLOC-1 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0031082
GO:0043015 [MF]gamma-tubulin bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0000930 [CC]gamma-tubulin complexprobableGO:0043234, GO:0005737, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005815, GO:0044446, GO:0044444, GO:0044430, GO:0044450, GO:0044424, GO:0043228, GO:0005622, GO:0043226, GO:0044422
GO:0016197 [BP]endosomal transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0008089 [BP]anterograde axon cargo transportprobableGO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0008088, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0044699, GO:0051641
GO:0048490 [BP]anterograde synaptic vesicle transportprobableGO:0019226, GO:0035637, GO:0051649, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0097480, GO:0097479, GO:0051641, GO:0032501, GO:0050877, GO:0006810, GO:0044765, GO:0008150, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051640, GO:0003008, GO:0044700, GO:0016192, GO:0044707, GO:0044763, GO:0009987
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IEQ, chain A
Confidence level:probable
Coverage over the Query: 68-128
View the alignment between query and template
View the model in PyMOL
Template: 3MQ9, chain A
Confidence level:probable
Coverage over the Query: 28-53
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2avr, chain Xconfident Alignment | Template Structure