Diaphorina citri psyllid: psy890

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MYILFYLVFPGDIAFRFLNYVDKLPPNTLSEHCAPHVTVADINRAMLDVGEQRARDLFKVPVPNPRLRFLEANAEELPIESDSYSAYTIAFGIRNVTRIDKALSEAYRVLKPGGRFLCLEFSHVNNSMLQW
cEEEEEccccHHHHHHHHHHHccccccccccccccEEEEEEccHHHHHHHHHHHHHcccccccccccEEEEccccccccccccCEEEEEEccccccccHHHHHHHHHHccccccEEEEEEccccccccccc
MYILFYLVFPGDIAFRFLNYVDKLPPN*LSEHCAPHVTVADINRAMLDVGEQRARDLFKVPVPNPRLRFLEANAEELPIESDSYSAYTIAFGIRNVTRIDKALSEAYRVLKPGGRFLCLEFSHVNNSMLQW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYILFYLVFPGDIAFRFLNYVDKLPPNTLSEHCAPHVTVADINRAMLDVGEQRARDLFKVPVPNPRLRFLEANAEELPIESDSYSAYTIAFGIRNVTRIDKALSEAYRVLKPGGRFLCLEFSHVNNSMLQW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquinone/menaquinone biosynthesis methyltransferase ubiE Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).confidentB9JZF4
Ubiquinone/menaquinone biosynthesis methyltransferase ubiE Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).confidentA1UUE1
Ubiquinone/menaquinone biosynthesis methyltransferase ubiE Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).confidentC3MCY6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XXL, chain A
Confidence level:very confident
Coverage over the Query: 1-20,34-125
View the alignment between query and template
View the model in PyMOL