Diaphorina citri psyllid: psy8922

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---
MIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWWYFRSIDNEKELSQMSSDQSYYRPRTRAITSSTRTEPGIRTTTRPTCTKPGIRTITSTACTEPGIRTITRSTCTKPGIRTITKPLLVPLALSRELEPLLVPLALSRELEPLLVPLALSRELEPLLVPLALRRELELLLVVLELSRELEPSLALSRELEPLLVPPTLSRELEPLLEKEQQPQENTTTTAVTTPEVESELMIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTEKEQQPQENTTTTAVTTPEVESELMIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWCVFNHIKQASDLRVGCDYSLFKSGIRPMWEDETNKNGGRWLISLDRKQRSSELNAFWLEILLCLIGEAFDDYSEDICGAVVNVRAKGDKIGIWTVDASRSKSDGILSIGRKIKERLGIGAEYQIVYQSHRDTASRTSSTSKNSFTL
cccccccccEEEEEEccccccccHHHccEEEEEccHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccCEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEECcccccccHHccEEEEEEccHHHHHHHHccccccccccccccccEEEccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHccccccccccEEEEEEEEcccccEEEEEcccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccCEEc
MIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWWYFRSIDNEKELSQMSSDQSYYRPRTRAITSSTRTEPGIRTTTRPTCTKPGIRTITSTACTEPGIRTITRSTCTKPGIRTITKPLLVPLALSRELEPLLVPLALSRELEPLLVPLALSRELEPLLVPLALRRELELLLVVLELSREL**************************************************LMIKHPLHNKWTLWYFEND****************************************LMIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWCVFNHIKQASDLRVGCDYSLFKSGIRPMWEDETNKNGGRWLISLDRKQRSSELNAFWLEILLCLIGEAFDDYSEDICGAVVNVRAKGDKIGIWTVDASRSKSDGILSIGRKIKERLGIGAEYQIVYQ*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWWYFRSIDNEKELSQMSSDQSYYRPRTRAITSSTRTEPGIRTTTRPTCTKPGIRTITSTACTEPGIRTITRSTCTKPGIRTITKPLLVPLALSRELEPLLVPLALSRELEPLLVPLALSRELEPLLVPLALRRELELLLVVLELSRELEPSLALSRELEPLLVPPTLSRELEPLLEKEQQPQENTTTTAVTTPEVESELMIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTEKEQQPQENTTTTAVTTPEVESELMIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWCVFNHIKQASDLRVGCDYSLFKSGIRPMWEDETNKNGGRWLISLDRKQRSSELNAFWLEILLCLIGEAFDDYSEDICGAVVNVRAKGDKIGIWTVDASRSKSDGILSIGRKIKERLGIGAEYQIVYQSHRDTASRTSSTSKNSFTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 4E Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates the binding to the mRNA cap (By similarity). Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. May play an important role in spermatogenesis through translational regulation of stage-specific mRNAs during germ cell development.confidentP63074
Eukaryotic translation initiation factor 4E Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.confidentP48598
Eukaryotic translation initiation factor 4E Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. May play an important role in spermatogenesis through translational regulation of stage-specific mRNAs during germ cell development (By similarity). Its translation stimulation activity is repressed by binding to the complex CYFIP1-FMR1. Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates the binding to the mRNA cap.confidentP63073

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000340 [MF]RNA 7-methylguanosine cap bindingprobableGO:0000339, GO:0003674, GO:0005488, GO:0003676, GO:0097159, GO:1901363, GO:0003723
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0022402 [BP]cell cycle processprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0000278 [BP]mitotic cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0006413 [BP]translational initiationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699
GO:0033391 [CC]chromatoid bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016442 [CC]RNA-induced silencing complexprobableGO:0032991, GO:0031332, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0031370 [MF]eukaryotic initiation factor 4G bindingprobableGO:0031369, GO:0003674, GO:0005488, GO:0005515
GO:0016281 [CC]eukaryotic translation initiation factor 4F complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005845 [CC]mRNA cap binding complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0034518, GO:0044424
GO:2000767 [BP]positive regulation of cytoplasmic translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:2000765, GO:0065007, GO:0045727, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0048518, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IPB, chain A
Confidence level:very confident
Coverage over the Query: 296-483
View the alignment between query and template
View the model in PyMOL
Template: 1IPB, chain A
Confidence level:very confident
Coverage over the Query: 1-70,83-108
View the alignment between query and template
View the model in PyMOL