Diaphorina citri psyllid: psy8925


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MNETKKSLYPSSLNKEKEQQPQENTTTTAVTTPEVESELMIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWW
ccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccHHHccEEEEEcccccccc
**************************************LMIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNETKKSLYPSSLNKEKEQQPQENTTTTAVTTPEVESELMIKHPLHNKWTLWYFENDKNKGWEENQREITSFSTVEDFWW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 4E Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.confidentQ75AV8
Eukaryotic translation initiation factor 4E-3 Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. All 5 eIF4E proteins bind monomethyl cap structures. Only ife-1, ife-2 and ife-5 bind trimethyl cap structures which result from trans-splicing. Translation of trimethyl cap structure mRNAs may be regulated by intracellular redox state; disulfide bonds change the width and depth of the cap-binding cavity determining selectivity to mRNA caps. Ife-3 is essential for viability.confidentO61955
Eukaryotic translation initiation factor 4E Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates the binding to the mRNA cap.confidentQ9N0T5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000340 [MF]RNA 7-methylguanosine cap bindingprobableGO:0000339, GO:0003674, GO:0005488, GO:0003676, GO:0097159, GO:1901363, GO:0003723
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0031370 [MF]eukaryotic initiation factor 4G bindingprobableGO:0031369, GO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0032266 [MF]phosphatidylinositol-3-phosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:2000767 [BP]positive regulation of cytoplasmic translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:2000765, GO:0065007, GO:0045727, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0048518, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IPB, chain A
Confidence level:very confident
Coverage over the Query: 33-80
View the alignment between query and template
View the model in PyMOL