Diaphorina citri psyllid: psy8934

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
STPAEDVESVPLAQSLLNAICDLLFCPDFTVASNKKFNSRKKMDYILNCTLSFGGLKLGTQDNLFINYLSRIHRDEDFQFVLAGFSRLLNNPLLQTYLPNSTKKIEFHQELLVLFWKMCDYNKHNKESR
cccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccc
*******ESVPLAQSLLNAICDLLFCPDFTVASNKKFNSRKKMDYILNCTLSFGGLKLGTQDNLFINYLSRIHRDEDFQFVLAGFSRLLNNPLLQTYLPNSTKKIEFHQELLVLFWKMCDYNKHN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
STPAEDVESVPLAQSLLNAICDLLFCPDFTVASNKKFNSRKKMDYILNCTLSFGGLKLGTQDNLFINYLSRIHRDEDFQFVLAGFSRLLNNPLLQTYLPNSTKKIEFHQELLVLFWKMCDYNKHNKESR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein HID1 confidentQ8R1F6
Protein HID1 May play an important role in the development of cancers in a broad range of tissues.confidentQ8IV36

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0090498 [CC]extrinsic to Golgi membraneprobableGO:0019898, GO:0043229, GO:0000139, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0044431, GO:0005794, GO:0031312, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0005797 [CC]Golgi medial cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0031001 [BP]response to brefeldin AprobableGO:1901700, GO:0050896, GO:0009636, GO:0008150, GO:0046677, GO:0042221, GO:0010033, GO:0014070
GO:0000138 [CC]Golgi trans cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted