Diaphorina citri psyllid: psy8943


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYFKKSEDNRN
ccCEEEEcccCCccccHHHccccccccccEEEEccEEEEEEEcccccccEEEEEEEEEccEEEEEEEccEEEECcccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHHccccc
*IAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYF*KSE****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYFKKSEDNRN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FIM, chain B
Confidence level:very confident
Coverage over the Query: 2-93
View the alignment between query and template
View the model in PyMOL
Template: 3Q9T, chain A
Confidence level:very confident
Coverage over the Query: 87-132
View the alignment between query and template
View the model in PyMOL