Psyllid ID: psy8943

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYFKKSEDNRN
ccEEEEEcccEEccccHHHccccccccccEEEEccEEEEEEEcccccccEEEEEEEEEccEEEEEEEccEEEEEcccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHHccccc
cccEEEEccccccHHHHHHHHHHHcccccEEEEEEEEEEEEEEccccccEEEEEEEEEccEEEEEEEEEEEEEccHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHccccccHHHHHHHHHHHccccc
miaqgtirrgsrcstskaflRPIRLRKNLHIAMETQALRLLfdksgpvpkaVGIEILRDGRKHIIRAKKEIIssagainspqllMVSGGSSVLNAMIYVRGnkndydqwerlgnsgwgykdvlpyfkksednrn
miaqgtirrgsrcstskaflrpiRLRKNLHIAMETQALrllfdksgpvPKAVGIEILRDGRKHIIRAKKEIissagainspqLLMVSGGSSVLNAMIYVRGNKNDYDQWErlgnsgwgykdvlpyfkksednrn
MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYFKKSEDNRN
****************KAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYF********
MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYF*KSE****
**************TSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYFKKSEDNRN
*IAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYFKKSE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHIIRAKKEIISSAGAINSPQLLMVSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYFKKSEDNRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query134 2.2.26 [Sep-21-2011]
P18173 625 Glucose dehydrogenase [ac no N/A 0.328 0.070 0.702 9e-15
P18172 625 Glucose dehydrogenase [ac no N/A 0.328 0.070 0.659 1e-14
Q6UPE0 599 Choline dehydrogenase, mi yes N/A 0.589 0.131 0.469 3e-14
P64264 528 Uncharacterized GMC-type yes N/A 0.589 0.149 0.457 7e-14
P64263 528 Uncharacterized GMC-type yes N/A 0.589 0.149 0.457 7e-14
Q8BJ64 596 Choline dehydrogenase, mi yes N/A 0.589 0.132 0.445 1e-13
Q8NE62 594 Choline dehydrogenase, mi yes N/A 0.589 0.132 0.469 1e-12
Q985M5 550 Choline dehydrogenase OS= no N/A 0.313 0.076 0.595 3e-12
C3MIE4 549 Choline dehydrogenase OS= no N/A 0.320 0.078 0.583 8e-12
Q1MJU4 549 Choline dehydrogenase OS= no N/A 0.320 0.078 0.583 1e-11
>sp|P18173|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (78%)

Query: 86  VSGGSSVLNAMIYVRGNKNDYDQWERLGNSGWGYKDVLPYFKKSEDN 132
           V GG+SVLN M+YVRGN+ DYD W   GN GW Y DVLP+FKKSEDN
Sbjct: 146 VLGGTSVLNGMMYVRGNREDYDDWAADGNPGWAYNDVLPFFKKSEDN 192
Essential for cuticular modification during development.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0
>sp|P18172|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 Back     alignment and function description
>sp|Q6UPE0|CHDH_RAT Choline dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Chdh PE=1 SV=1 Back     alignment and function description
>sp|P64264|Y1310_MYCBO Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1310 PE=3 SV=1 Back     alignment and function description
>sp|P64263|Y1279_MYCTU Uncharacterized GMC-type oxidoreductase Rv1279/MT1316 OS=Mycobacterium tuberculosis GN=Rv1279 PE=3 SV=1 Back     alignment and function description
>sp|Q8BJ64|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1 Back     alignment and function description
>sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=2 SV=2 Back     alignment and function description
>sp|Q985M5|BETA_RHILO Choline dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|C3MIE4|BETA_RHISN Choline dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q1MJU4|BETA_RHIL3 Choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
383860468 621 PREDICTED: glucose dehydrogenase [accept 0.634 0.136 0.659 2e-26
332023084 634 Glucose dehydrogenase [Acromyrmex echina 0.641 0.135 0.659 7e-26
157104210 620 glucose dehydrogenase [Aedes aegypti] gi 0.634 0.137 0.662 8e-26
347970615 621 AGAP003782-PA [Anopheles gambiae str. PE 0.641 0.138 0.659 1e-25
383860470 624 PREDICTED: glucose dehydrogenase [accept 0.634 0.136 0.651 1e-25
347970617 497 AGAP003782-PB [Anopheles gambiae str. PE 0.641 0.173 0.659 1e-25
170030779 646 glucose dehydrogenase [Culex quinquefasc 0.641 0.133 0.625 2e-25
48094605 612 PREDICTED: glucose dehydrogenase [accept 0.634 0.138 0.636 2e-25
328785230 625 PREDICTED: glucose dehydrogenase [accept 0.634 0.136 0.651 7e-25
322796401 624 hypothetical protein SINV_00375 [Solenop 0.641 0.137 0.636 1e-24
>gi|383860468|ref|XP_003705711.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/88 (65%), Positives = 74/88 (84%), Gaps = 3/88 (3%)

Query: 1   MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDG 60
           M+ Q TIRRGSRCST+KAFLRP++ R+NLHIAM +QALR+LF+      +A G+EILRDG
Sbjct: 235 MLTQATIRRGSRCSTAKAFLRPVKNRENLHIAMHSQALRVLFNDDK---RATGVEILRDG 291

Query: 61  RKHIIRAKKEIISSAGAINSPQLLMVSG 88
           R+ +IR ++EI+ SAGAINSPQLLM+SG
Sbjct: 292 RQQVIRVRREIVLSAGAINSPQLLMLSG 319

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|332023084|gb|EGI63349.1| Glucose dehydrogenase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157104210|ref|XP_001648302.1| glucose dehydrogenase [Aedes aegypti] gi|108880417|gb|EAT44642.1| AAEL004003-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|347970615|ref|XP_559558.6| AGAP003782-PA [Anopheles gambiae str. PEST] gi|333466753|gb|EAL41335.4| AGAP003782-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|383860470|ref|XP_003705712.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|347970617|ref|XP_003436610.1| AGAP003782-PB [Anopheles gambiae str. PEST] gi|333466754|gb|EGK96364.1| AGAP003782-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170030779|ref|XP_001843265.1| glucose dehydrogenase [Culex quinquefasciatus] gi|167868384|gb|EDS31767.1| glucose dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|48094605|ref|XP_394221.1| PREDICTED: glucose dehydrogenase [acceptor] [Apis mellifera] Back     alignment and taxonomy information
>gi|328785230|ref|XP_003250566.1| PREDICTED: glucose dehydrogenase [acceptor]-like isoform 1 [Apis mellifera] gi|328785232|ref|XP_003250567.1| PREDICTED: glucose dehydrogenase [acceptor]-like isoform 2 [Apis mellifera] gi|328785234|ref|XP_003250568.1| PREDICTED: glucose dehydrogenase [acceptor]-like isoform 3 [Apis mellifera] Back     alignment and taxonomy information
>gi|322796401|gb|EFZ18935.1| hypothetical protein SINV_00375 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
FB|FBgn0030598 626 CG9503 [Drosophila melanogaste 0.634 0.135 0.595 1e-21
FB|FBgn0030591 865 CG9517 [Drosophila melanogaste 0.634 0.098 0.522 5.2e-21
FB|FBgn0030590 703 CG9518 [Drosophila melanogaste 0.641 0.122 0.556 2e-20
FB|FBgn0039415 616 CG6142 [Drosophila melanogaste 0.619 0.134 0.528 1.7e-18
FB|FBgn0030592 726 CG9514 [Drosophila melanogaste 0.365 0.067 0.693 1.9e-15
FB|FBgn0030588 621 CG9521 [Drosophila melanogaste 0.335 0.072 0.733 7.6e-14
FB|FBgn0001112 625 Gld "Glucose dehydrogenase" [D 0.350 0.075 0.702 7.6e-14
FB|FBgn0030589 622 CG9519 [Drosophila melanogaste 0.335 0.072 0.711 2e-13
UNIPROTKB|Q47YL1 539 CPS_3434 "Oxidoreductase, GMC 0.335 0.083 0.666 2.6e-13
TIGR_CMR|CPS_3434 539 CPS_3434 "oxidoreductase, GMC 0.335 0.083 0.666 2.6e-13
FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 262 (97.3 bits), Expect = 1.0e-21, P = 1.0e-21
 Identities = 53/89 (59%), Positives = 68/89 (76%)

Query:     1 MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPK-AVGIEILRD 59
             MIAQGT RRGSRCSTSKAFLRP RLR NLHI+M +   R++ D   PV K A G+E ++D
Sbjct:   242 MIAQGTTRRGSRCSTSKAFLRPARLRPNLHISMNSHVTRIMID---PVTKLAFGVEFVKD 298

Query:    60 GRKHIIRAKKEIISSAGAINSPQLLMVSG 88
              + + +RA KE++ S G++NSPQLLM+SG
Sbjct:   299 QKLYHVRATKEVVLSGGSVNSPQLLMLSG 327
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006066 "alcohol metabolic process" evidence=IEA
GO:0008812 "choline dehydrogenase activity" evidence=IEA
FB|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q47YL1 CPS_3434 "Oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3434 CPS_3434 "oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
PRK02106 560 PRK02106, PRK02106, choline dehydrogenase; Validat 5e-26
COG2303 542 COG2303, BetA, Choline dehydrogenase and related f 2e-19
PRK02106 560 PRK02106, PRK02106, choline dehydrogenase; Validat 3e-18
TIGR01810 532 TIGR01810, betA, choline dehydrogenase 8e-18
COG2303 542 COG2303, BetA, Choline dehydrogenase and related f 2e-16
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 3e-15
TIGR01810 532 TIGR01810, betA, choline dehydrogenase 2e-13
TIGR03970 487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 2e-13
pfam00732 218 pfam00732, GMC_oxred_N, GMC oxidoreductase 1e-12
PLN02785 587 PLN02785, PLN02785, Protein HOTHEAD 4e-08
TIGR03970 487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 9e-08
PRK07121 492 PRK07121, PRK07121, hypothetical protein; Validate 6e-04
PRK06263 543 PRK06263, sdhA, succinate dehydrogenase flavoprote 0.002
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information 
 Score =  101 bits (254), Expect = 5e-26
 Identities = 37/83 (44%), Positives = 50/83 (60%), Gaps = 4/83 (4%)

Query: 6   TIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRDGRKHII 65
           T+  G R S ++A+L P   R NL I       R+LF+      +AVG+E  R G +   
Sbjct: 193 TVTNGRRWSAARAYLDPALKRPNLTIVTHALTDRILFEG----KRAVGVEYERGGGRETA 248

Query: 66  RAKKEIISSAGAINSPQLLMVSG 88
           RA++E+I SAGAINSPQLL +SG
Sbjct: 249 RARREVILSAGAINSPQLLQLSG 271

Length = 560
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|180854 PRK07121, PRK07121, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|235758 PRK06263, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 134
KOG1238|consensus 623 99.8
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 99.78
PRK02106 560 choline dehydrogenase; Validated 99.76
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 99.76
PLN02785 587 Protein HOTHEAD 99.61
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 99.61
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 99.4
KOG1238|consensus 623 99.13
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 98.66
PRK02106 560 choline dehydrogenase; Validated 98.56
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 98.37
PF00732 296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.13
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.57
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.52
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.33
PLN02785 587 Protein HOTHEAD 97.19
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.18
PRK07121 492 hypothetical protein; Validated 97.04
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.82
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 96.79
PRK12839 572 hypothetical protein; Provisional 96.72
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 96.65
PRK06175 433 L-aspartate oxidase; Provisional 96.57
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 96.54
PRK13977 576 myosin-cross-reactive antigen; Provisional 96.53
PRK08274 466 tricarballylate dehydrogenase; Validated 96.37
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 96.3
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 96.2
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 96.17
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 96.05
PRK12842 574 putative succinate dehydrogenase; Reviewed 96.01
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 95.97
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 95.88
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 95.86
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 95.78
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 95.77
PRK07395 553 L-aspartate oxidase; Provisional 95.69
PLN02815 594 L-aspartate oxidase 95.66
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 95.64
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 95.6
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 95.53
PRK08275 554 putative oxidoreductase; Provisional 95.41
PRK07512 513 L-aspartate oxidase; Provisional 95.41
PRK09077 536 L-aspartate oxidase; Provisional 95.34
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 95.32
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 95.25
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 95.23
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 95.23
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 95.19
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 95.18
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 94.99
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 94.95
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 94.94
KOG2404|consensus 477 94.92
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 94.9
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 94.87
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 94.83
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 94.83
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 94.75
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 94.74
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 94.57
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 94.44
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 94.39
PRK08071 510 L-aspartate oxidase; Provisional 93.84
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 93.64
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 93.58
PRK07804 541 L-aspartate oxidase; Provisional 93.46
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 93.34
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 93.15
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 93.13
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 92.85
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 92.71
PLN02464 627 glycerol-3-phosphate dehydrogenase 92.53
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 89.88
PRK06185 407 hypothetical protein; Provisional 89.83
PRK05257 494 malate:quinone oxidoreductase; Validated 89.51
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 88.81
PLN02661357 Putative thiazole synthesis 88.54
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 88.35
PLN02487 569 zeta-carotene desaturase 88.15
PF06100 500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 87.83
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 87.69
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 87.58
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 87.27
PRK13339 497 malate:quinone oxidoreductase; Reviewed 87.25
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 86.7
COG0579 429 Predicted dehydrogenase [General function predicti 86.59
PTZ00383 497 malate:quinone oxidoreductase; Provisional 86.04
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 85.84
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 85.25
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 83.71
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 83.68
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 83.53
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 82.37
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 82.1
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 81.28
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 80.99
>KOG1238|consensus Back     alignment and domain information 
Probab=99.80  E-value=7.8e-20  Score=155.18  Aligned_cols=92  Identities=51%  Similarity=0.768  Sum_probs=84.5

Q ss_pred             cccccccCCeeechhhhhhhhhhc-CCCeEEEccceEEEEEeccCCCCCeEEEEEEEeC-CeEEEEEeceEEEecCCccc
Q psy8943           2 IAQGTIRRGSRCSTSKAFLRPIRL-RKNLHIAMETQALRLLFDKSGPVPKAVGIEILRD-GRKHIIRAKKEIISSAGAIN   79 (134)
Q Consensus         2 ~~~~~~~~g~R~sa~~~~l~~~~~-~~nl~i~t~~~V~ri~~~~~~~~~~a~gV~~~~~-g~~~~~~a~~~vIlaaGai~   79 (134)
                      +.+.++++|.|.|+..+|++|+.. |+||++..++.|+||++|..  +.++.||++..+ ++.++++++||||||||||+
T Consensus       241 ~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~--~~~a~gv~~~~~~~~~~~v~a~kEVILSAGAi~  318 (623)
T KOG1238|consen  241 LLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPA--GKRAKGVEFVRDGGKEHTVKARKEVILSAGAIN  318 (623)
T ss_pred             hhhccccCCEEEEehhhhhhhhhccCccccccccceEEEEEEcCC--CceEEEEEEEecCceeeeecccceEEEeccccC
Confidence            568899999999999999999876 89999999999999999952  348999999998 89999999999999999999


Q ss_pred             CCchhhhcccccccce
Q psy8943          80 SPQLLMVSGGSSVLNA   95 (134)
Q Consensus        80 tP~lLl~SGig~~~n~   95 (134)
                      ||||||+|||||+.+|
T Consensus       319 SPQLLMLSGIGP~~~L  334 (623)
T KOG1238|consen  319 SPQLLMLSGIGPADHL  334 (623)
T ss_pred             CHHHHHHcCCCcHHHH
Confidence            9999999999999754

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
3nne_A 546 Crystal Structure Of Choline Oxidase S101a Mutant L 1e-07
2jbv_A 546 Crystal Structure Of Choline Oxidase Reveals Insigh 1e-07
3ljp_A 546 Crystal Structure Of Choline Oxidase V464a Mutant L 1e-07
3q9t_A 577 Crystal Structure Analysis Of Formate Oxidase Lengt 2e-06
3fim_B 566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 4e-06
1cf3_A 583 Glucose Oxidase From Apergillus Niger Length = 583 4e-06
3t37_A 526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 1e-05
3red_A 521 3.0 A Structure Of The Prunus Mume Hydroxynitrile L 1e-04
1ju2_A 536 Crystal Structure Of The Hydroxynitrile Lyase From 2e-04
3gdn_A 521 Almond Hydroxynitrile Lyase In Complex With Benzald 2e-04
1gpe_A 587 Glucose Oxidase From Penicillium Amagasakiense Leng 5e-04
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 5/81 (6%)
Query: 10  GSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILRD--GRKHIIRA 67
           G+R S+S +++ PI  ++N  +    +A +L+FD      +  G++I+    G  H + A
Sbjct: 205 GTRSSSSVSYIHPIVEQENFTLLTGLRARQLVFDAD---RRCTGVDIVDSAFGHTHRLTA 261
Query: 68  KKEIISSAGAINSPQLLMVSG 88
           + E++ S GAI++P+LLM+SG
Sbjct: 262 RNEVVLSTGAIDTPKLLMLSG 282
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 Back     alignment and structure
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 2e-40
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 2e-27
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 6e-39
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 9e-28
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 2e-38
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 4e-28
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 4e-35
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 3e-24
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 5e-33
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 4e-25
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 8e-33
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 7e-30
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 3e-32
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 4e-25
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 5e-31
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 2e-19
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 3e-07
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 1e-05
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 2e-04
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 4e-04
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
 Score =  140 bits (356), Expect = 2e-40
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query: 1   MIAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFD---KSGPVPKAVGIEIL 57
             +  ++  G R S+S A+LRP + R NL + +  Q  +L+        P  + V     
Sbjct: 195 SWSIASVGNGQRSSSSTAYLRPAQSRPNLSVLINAQVTKLVNSGTTNGLPAFRCVEYAEQ 254

Query: 58  RDGRKHIIRAKKEIISSAGAINSPQLLMVSG 88
                  + AKKE++ SAG++ +P LL +SG
Sbjct: 255 EGAPTTTVCAKKEVVLSAGSVGTPILLQLSG 285
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 99.84
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 99.83
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 99.73
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 99.69
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 99.66
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 99.64
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 99.55
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 99.53
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 99.5
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 99.46
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 99.06
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.85
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.83
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 98.75
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 98.68
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.44
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.35
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.81
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.7
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.62
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.68
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 96.27
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.22
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.11
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 96.03
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 95.83
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.48
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 95.44
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 95.39
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 95.1
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 94.98
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.84
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 94.82
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 94.03
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 93.58
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 93.47
3dme_A 369 Conserved exported protein; structural genomics, P 93.45
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 93.41
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 93.39
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 93.35
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 93.26
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 93.02
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 93.0
3atr_A 453 Conserved archaeal protein; saturating double bond 92.94
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 92.63
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 91.57
3r9u_A315 Thioredoxin reductase; structural genomics, center 91.51
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 91.33
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 90.97
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 90.88
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 90.73
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 90.67
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 90.52
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 90.18
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 89.88
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 89.7
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 89.1
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 88.88
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 87.6
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 87.56
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 87.46
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 87.24
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 87.24
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 87.13
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 86.47
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 86.45
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 85.95
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 85.52
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 85.37
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 85.32
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 84.88
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 84.69
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 84.38
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 84.25
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 83.56
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 83.51
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 83.07
2cul_A232 Glucose-inhibited division protein A-related PROT 82.94
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 82.34
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 81.89
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 81.41
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 81.2
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 81.06
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 80.8
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 80.35
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
Probab=99.84  E-value=3.4e-21  Score=163.09  Aligned_cols=92  Identities=28%  Similarity=0.442  Sum_probs=81.7

Q ss_pred             ccccccc-CCeeechhhhhhhhhhcCCCeEEEccceEEEEEeccCCCCCeEEEEEEE-eCCeEEEEEeceEEEecCCccc
Q psy8943           2 IAQGTIR-RGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEIL-RDGRKHIIRAKKEIISSAGAIN   79 (134)
Q Consensus         2 ~~~~~~~-~g~R~sa~~~~l~~~~~~~nl~i~t~~~V~ri~~~~~~~~~~a~gV~~~-~~g~~~~~~a~~~vIlaaGai~   79 (134)
                      +++.+++ +|.|++++.+||.|++.++||+|++++.|+||+++..+.+++|+||++. .+|..++++|+||||||||+++
T Consensus       214 ~~~~t~~~~g~R~saa~ayL~p~~~r~NL~V~t~a~V~rIl~d~~~~~~ra~GV~~~~~~G~~~~v~A~kEVILsAGa~~  293 (583)
T 3qvp_A          214 MFPNTLHEDQVRSDAAREWLLPNYQRPNLQVLTGQYVGKVLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGSAV  293 (583)
T ss_dssp             CCCBSBCTTCBBCCHHHHHTTTTTTCTTEEEECSCEEEEEEEECSSSSCEEEEEEEESSTTCEEEEEEEEEEEECSCTTT
T ss_pred             ccceeEcCCCcEecHHHHHHHHhhcCCCcEEEcCCEEEEEEeccCCCCCEEEEEEEEecCCcEEEEEECCEEEEeCCccC
Confidence            4567775 7899999999999988899999999999999999853334699999998 4888899999999999999999


Q ss_pred             CCchhhhccccccc
Q psy8943          80 SPQLLMVSGGSSVL   93 (134)
Q Consensus        80 tP~lLl~SGig~~~   93 (134)
                      ||||||+||||+..
T Consensus       294 SPqLL~lSGIGp~~  307 (583)
T 3qvp_A          294 SPTILEYSGIGMKS  307 (583)
T ss_dssp             HHHHHHHTTBSCHH
T ss_pred             CHHHHHHcCCCCHH
Confidence            99999999999873
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 134
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 9e-18
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 5e-14
d1gpea1 391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 5e-04
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-12
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 2e-12
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 5e-12
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-10
d2f5va1 379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 6e-05
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 4e-08
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Aspergillus niger [TaxId: 5061]

 Score = 75.7 bits (185), Expect = 9e-18
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 13  CSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEIL-RDGRKHIIRAKKEI 71
              ++ +L P   R NL +       ++L  ++G  P+AVG+E     G  H + AK E+
Sbjct: 224 SDAAREWLLPNYQRPNLQVLTGQYVGKVLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEV 283

Query: 72  ISSAGAINSPQLLMVSGGS 90
           + +AG+  SP +L  SG  
Sbjct: 284 LLAAGSAVSPTILEYSGIG 302
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 99.82
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.8
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.8
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.74
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.43
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.35
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.2
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.61
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.59
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 97.62
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.46
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.4
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.26
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 97.13
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.03
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.51
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 96.29
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 95.98
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 95.35
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 95.27
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.19
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.46
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.12
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 93.88
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 93.48
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.03
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 92.96
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 92.93
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.7
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 91.46
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 91.04
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 90.07
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 90.06
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.88
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.85
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 88.59
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 87.95
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 87.57
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 85.38
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 83.39
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 82.24
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain
species: Fungus (Phanerochaete chrysosporium) [TaxId: 5306]

Probab=99.82  E-value=1.8e-21  Score=153.10  Aligned_cols=90  Identities=17%  Similarity=0.203  Sum_probs=80.4

Q ss_pred             cccccccCCeeechhhhhhhhhhcCCCeEEEccceEEEEEeccCCCCCeEEEEEEEe----CCeEEEEEeceEEEecCCc
Q psy8943           2 IAQGTIRRGSRCSTSKAFLRPIRLRKNLHIAMETQALRLLFDKSGPVPKAVGIEILR----DGRKHIIRAKKEIISSAGA   77 (134)
Q Consensus         2 ~~~~~~~~g~R~sa~~~~l~~~~~~~nl~i~t~~~V~ri~~~~~~~~~~a~gV~~~~----~g~~~~~~a~~~vIlaaGa   77 (134)
                      +++.++.+|.|+++..+||.++.+++||+|++++.|+||+++    +++|+||+|.+    .+....+.++++||||||+
T Consensus       179 ~~~~~~~~G~R~s~~~~yl~~a~~r~nl~i~t~~~V~rI~~d----~~ra~GV~~~~~~~~~~~~~~v~a~~eVILsAGa  254 (360)
T d1kdga1         179 YSAFDFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRN----GSQILGVQTNDPTLGPNGFIPVTPKGRVILSAGA  254 (360)
T ss_dssp             ECCBCEETTEECHHHHTHHHHHHTCTTEEEECSCCEEEEEEE----TTEEEEEEESCTTSSGGGEEEEEEEEEEEECSHH
T ss_pred             eeeeeccccccccccchhhhhhhcccccccccCcEEEEEEEe----CCEEEEEEEEecccCcceEEEEEECCEEEEechh
Confidence            456778899999999999999999999999999999999998    46999999986    2456788888999999999


Q ss_pred             ccCCchhhhcccccccce
Q psy8943          78 INSPQLLMVSGGSSVLNA   95 (134)
Q Consensus        78 i~tP~lLl~SGig~~~n~   95 (134)
                      |+||+|||+||||+...+
T Consensus       255 i~SP~LLl~SGIGp~~~L  272 (360)
T d1kdga1         255 FGTSRILFQSGIGPTDMI  272 (360)
T ss_dssp             HHHHHHHHHTTBSCHHHH
T ss_pred             HhChHHHHhcCCCchhhh
Confidence            999999999999998754
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure