Diaphorina citri psyllid: psy8971


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MALGNTVYNLLFKKTSSFMLTVAVGAFAFERGFDKLTDYVWESHNKGVNHPVLGAVLVQKSCPWNIATKGTVTNDHRGKGRTQLSLLPRSLQVSTPATKPSLNNNDSTPGSDSKTSTMKSNDDFRNMLLGKK
ccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHcccccccCEEcccCECccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccc
***GNTVYNLLFKKTSSFMLTVAVGAFAFERGFDKLTDYVWESHNKGVNHPVLGAVLVQKSCPWNIATKGTVTNDHRGKGRTQLSLL**************************************NMLLGK*
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALGNTVYNLLFKKTSSFMLTVAVGAFAFERGFDKLTDYVWESHNKGVNHPVLGAVLVQKSCPWNIATKGTVTNDHRGKGRTQLSLLPRSLQVSTPATKPSLNNNDSTPGSDSKTSTMKSNDDFRNMLLGKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome b-c1 complex subunit 9 This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1.confidentQ8R1I1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PP9, chain J
Confidence level:confident
Coverage over the Query: 1-60
View the alignment between query and template
View the model in PyMOL