Diaphorina citri psyllid: psy8972

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170

MKLAKFVKINLWKNIFGKECDKLERANDDERTYYLIEQESLVNKFISVPKDKGSLNCAIFVAGIVEAVLNNCGFKSTVTAHWHKGTTYMIQFDEQEGKFTALQIMEENIASQWRRGAGKVGRGACKGNQQLNYNLMAKPSGHDFCIILEPPLVRPRGYCEKLNSTTNKCD

cccHHHHHHHHHHHHccccccccccccccccEEEEEcccccEEEEEccccccccccccHHHHHHHHHHHHcccccCEEEEEEcccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccECcccccccCEEEEEccccccccccHHHccccccccc

MKLAKFVKINLWKNIFGKECDKLERANDDERTYYLIEQESLVNKFISVPKDKGSLNCAIFVAGIVEAVLNNCGFKSTVTAHWHKGTTYMIQFDEQEGKFTALQIMEENIASQWRRGAGKVGRGACKGNQQLNYNLMAKPSGHDFCIILEPPLVRPRGYCEKL********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKLAKFVKINLWKNIFGKECDKLERANDDERTYYLIEQESLVNKFISVPKDKGSLNCAIFVAGIVEAVLNNCGFKSTVTAHWHKGTTYMIQFDEQEGKFTALQIMEENIASQWRRGAGKVGRGACKGNQQLNYNLMAKPSGHDFCIILEPPLVRPRGYCEKLNSTTNKCD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Trafficking protein particle complex subunit 5	May play a role in vesicular transport from endoplasmic reticulum to Golgi.	confident	Q8IUR0
Trafficking protein particle complex subunit 5	May play a role in vesicular transport from endoplasmic reticulum to Golgi.	confident	Q2NL13
Trafficking protein particle complex subunit 5	May play a role in vesicular transport from endoplasmic reticulum to Golgi.	confident	Q9CQA1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003674 [MF]	molecular_function	probable
GO:0030008 [CC]	TRAPP complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3W, chain B
Confidence level:very confident
Coverage over the Query: 1-102
View the alignment between query and template
View the model in PyMOL