Diaphorina citri psyllid: psy8974


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MSCNYAEGLSPYENKGKLGLAETFDSKEDFDKKIKVLSEWIDKAKHVVLHTGAGISTSAGIPDFSGPHYWRRRVEELTK
cccHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccccHHHHHHccc
**CNYAE*********************DFDKKIKVLSEWIDKAKHVVLHTGAGISTSAGIPDFSGPHYWR********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCNYAEGLSPYENKGKLGLAETFDSKEDFDKKIKVLSEWIDKAKHVVLHTGAGISTSAGIPDFSGPHYWRRRVEELTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAD-dependent protein deacetylase sirtuin-6 NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. On DNA damage, promotes DNA end resection via deacetylation of RBBP8. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate (By similarity). Acts as a corepressor of the transcription factor Hif1a to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. Regulates the production of TNF protein. Has a role in the regulation of life span in male mice, but not in female mice.confidentP59941
NAD-dependent protein deacetylase SRT1 NAD-dependent protein deacetylase. Has deacetylase activity towards H3K9Ac. May have a function in the safeguard against genome instabiliy and DNA damage to ensure plant cell growth.confidentQ9FE17
NAD-dependent protein deacetylase Sirt6 NAD-dependent protein deacetylase (By similarity). May be involved in the regulation of life span.confidentQ9VH08

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006471 [BP]protein ADP-ribosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0006476 [BP]protein deacetylationprobableGO:0044267, GO:0035601, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0046969 [MF]NAD-dependent histone deacetylase activity (H3-K9 specific)probableGO:0016787, GO:0019213, GO:0003824, GO:0004407, GO:0016810, GO:0016811, GO:0017136, GO:0034979, GO:0032129, GO:0003674, GO:0033558
GO:0005488 [MF]bindingprobableGO:0003674
GO:0010569 [BP]regulation of double-strand break repair via homologous recombinationprobableGO:0006282, GO:0051052, GO:0019222, GO:0060255, GO:0048583, GO:0080134, GO:0080135, GO:0031323, GO:0000018, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:2000779, GO:2001020, GO:0050789, GO:0080090
GO:0003956 [MF]NAD(P)+-protein-arginine ADP-ribosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016763
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005724 [CC]nuclear telomeric heterochromatinprobableGO:0031933, GO:0031974, GO:0000781, GO:0043229, GO:0043228, GO:0000785, GO:0000784, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0005720, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0044699 [BP]single-organism processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K35, chain A
Confidence level:very confident
Coverage over the Query: 15-77
View the alignment between query and template
View the model in PyMOL