NAD-dependent protein deacetylase (By similarity). May be involved in the regulation of life span. Drosophila melanogaster (taxid: 7227) EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: -
>sp|P59941|SIR6_MOUSE NAD-dependent protein deacetylase sirtuin-6 OS=Mus musculus GN=Sirt6 PE=1 SV=1
NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. On DNA damage, promotes DNA end resection via deacetylation of RBBP8. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate (By similarity). Acts as a corepressor of the transcription factor Hif1a to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. Regulates the production of TNF protein. Has a role in the regulation of life span in male mice, but not in female mice.
Mus musculus (taxid: 10090)
EC: 3
EC: .
EC: 5
EC: .
EC: 1
EC: .
EC: -
>sp|Q8N6T7|SIR6_HUMAN NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens GN=SIRT6 PE=1 SV=2
NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Acts as a corepressor of the transcription factor HIF1A to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Regulates the production of TNF protein. Has a role in the regulation of life span (By similarity). Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. On DNA damage, promotes DNA end resection via deacetylation of RBBP8. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate.
Score = 75.1 bits (183), Expect = 1e-13, Method: Composition-based stats.
Identities = 37/67 (55%), Positives = 48/67 (71%)
Query: 1 MSCNYAEGLSPYENKGKLGLAETFDSKEDFDKKIKVLSEWIDKAKHVVLHTGAGISTSAG 60
MS YAE LS E+ G +G+ E FDS E KKI+ L+ + ++KH+V+ TGAGISTS+G
Sbjct: 1 MSLGYAEKLSYREDVGNVGMPEIFDSPELLHKKIEELAVMVRESKHLVVFTGAGISTSSG 60
Query: 61 IPDFSGP 67
IPDF GP
Sbjct: 61 IPDFRGP 67
NAD-dependent protein deacetylase. Has deacetylase activity towards H3K9Ac. May have a function in the safeguard against genome instabiliy and DNA damage to ensure plant cell growth.
Oryza sativa subsp. indica (taxid: 39946)
EC: 3
EC: .
EC: 5
EC: .
EC: 1
EC: .
EC: -
>sp|Q9FE17|SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana GN=SRT1 PE=2 SV=1
Score = 74.7 bits (182), Expect = 2e-13, Method: Compositional matrix adjust.
Identities = 37/67 (55%), Positives = 47/67 (70%)
Query: 1 MSCNYAEGLSPYENKGKLGLAETFDSKEDFDKKIKVLSEWIDKAKHVVLHTGAGISTSAG 60
MS YAE LS E+ G++G+AE FD KI+ L++ I K+KH+V+ TGAGISTS G
Sbjct: 1 MSLGYAEKLSFIEDVGQVGMAEFFDPSHLLQCKIEELAKLIQKSKHLVVFTGAGISTSCG 60
Query: 61 IPDFSGP 67
IPDF GP
Sbjct: 61 IPDFRGP 67
NAD-dependent protein deacetylase. Has deacetylase activity towards H3K9Ac. May have a function in the safeguard against genome instabiliy and DNA damage to ensure plant cell growth.
Arabidopsis thaliana (taxid: 3702)
EC: 3
EC: .
EC: 5
EC: .
EC: 1
EC: .
EC: -
>sp|B2RZ55|SIR7_RAT NAD-dependent protein deacetylase sirtuin-7 OS=Rattus norvegicus GN=Sirt7 PE=2 SV=1
NAD-dependent protein deacetylase that specifically mediates deacetylation of histone H3 at 'Lys-18' (H3K18Ac). In contrast to other histone deacetylases, displays selectivity for a single histone mark, H3K18Ac, directly linked to control of gene expression. H3K18Ac is mainly present around the transcription start site of genes and has been linked to activation of nuclear hormone receptors. SIRT7 thereby acts as a transcription repressor. Moreover, H3K18 hypoacetylation has been reported as a marker of malignancy in various cancers and seems to maintain the transformed phenotype of cancer cells. These data suggest that SIRT7 may play a key role in oncogenic transformation by suppresses expression of tumor suppressor genes by locus-specific deacetylation of H3K18Ac at promoter regions. Also required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis: promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex. May also deacetylate p53/TP53 and promotes cell survival, however such data need additional confirmation.
Rattus norvegicus (taxid: 10116)
EC: 3
EC: .
EC: 5
EC: .
EC: 1
EC: .
EC: -
>sp|Q8BKJ9|SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus GN=Sirt7 PE=1 SV=2
NAD-dependent protein deacetylase. Required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis. Promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex.
Score = 50.1 bits (118), Expect = 4e-06, Method: Composition-based stats.
Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
Query: 1 MSC-NYAEGLSPYENKGKLGLAETFDSKEDFDKKIKVLSEWIDKAKHVVLHTGAGISTSA 59
MSC NYA LS E KG LG E F+ E+ KK+K L E I ++++V+H+GAGISTS+
Sbjct: 1 MSCMNYASRLSKNEYKGPLGEEEFFEDTEEEKKKVKELIEKIRSSEYIVVHSGAGISTSS 60
Query: 60 GIPDFSGP 67
G+ DF GP
Sbjct: 61 GLQDFRGP 68
Regulates the expression of the surface antigen-coding var genes central to the malaria pathogenesis. Cooperates with Sir2A to mediate silencing and mutual exclusive expression of only 1 of the 60 subtelomeric var genes at a time, coding for functionally different but epitopically variant versions of the erythrocyte membrane protein 1 (PfEMP1) molecule, to evade the detection by host immune surveillance.
NAD-dependent protein deacetylase. Required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis. Promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex.
Bos taurus (taxid: 9913)
EC: 3
EC: .
EC: 5
EC: .
EC: 1
EC: .
EC: -
>sp|Q9NRC8|SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens GN=SIRT7 PE=1 SV=1
NAD-dependent protein deacetylase. Required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis. Promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex.
Homo sapiens (taxid: 9606)
EC: 3
EC: .
EC: 5
EC: .
EC: 1
EC: .
EC: -
Close Homologs in the Non-Redundant Database Detected by BLAST
>gi|91077210|ref|XP_973096.1| PREDICTED: similar to chromatin regulatory protein sir2 [Tribolium castaneum] gi|270002055|gb|EEZ98502.1| hypothetical protein TcasGA2_TC001003 [Tribolium castaneum]
>gnl|CDD|238701 cd01410, SIRT7, SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. Length = 206
>gnl|CDD|238698 cd01407, SIR2-fam, SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose
Score = 54.1 bits (131), Expect = 1e-10
Identities = 20/35 (57%), Positives = 23/35 (65%), Gaps = 2/35 (5%)
Query: 45 KHVVLHTGAGISTSAGIPDFSGPH-YWRR-RVEEL 77
K +V+ TGAGIST +GIPDF P W R EEL
Sbjct: 1 KRIVVLTGAGISTESGIPDFRSPGGLWARLDPEEL 35
Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Length = 218
>gnl|CDD|238184 cd00296, SIR2, SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose
Score = 52.3 bits (126), Expect = 6e-10
Identities = 21/36 (58%), Positives = 23/36 (63%), Gaps = 3/36 (8%)
Query: 45 KHVVLHTGAGISTSAGIPDFSGP--HYWRR-RVEEL 77
K VV+ TGAGIST +GIPDF G W R EEL
Sbjct: 1 KRVVVFTGAGISTESGIPDFRGLGTGLWTRLDPEEL 36
Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Also included in this superfamily is a group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines. Length = 222
>gnl|CDD|223915 COG0846, SIR2, NAD-dependent protein deacetylases, SIR2 family [Transcription]
>gnl|CDD|238704 cd01413, SIR2_Af2, SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression. Length = 222
>gnl|CDD|238702 cd01411, SIR2H, SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. Length = 225
>gnl|CDD|238699 cd01408, SIRT1, SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity. Length = 235
>gnl|CDD|238703 cd01412, SIRT5_Af1_CobB, SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E
Score = 42.2 bits (100), Expect = 4e-06
Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 2/35 (5%)
Query: 45 KHVVLHTGAGISTSAGIPDFSGPH-YWRR-RVEEL 77
+ VV+ TGAGIS +GIP F W R EEL
Sbjct: 1 RRVVVLTGAGISAESGIPTFRDADGLWARFDPEEL 35
coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity. . Length = 224
Score = 41.0 bits (96), Expect = 1e-05
Identities = 16/29 (55%), Positives = 22/29 (75%)
Query: 39 EWIDKAKHVVLHTGAGISTSAGIPDFSGP 67
E +++++ V TGAGIST +GIPDF GP
Sbjct: 6 ELLNESRLTVTLTGAGISTPSGIPDFRGP 34
Length = 244
>gnl|CDD|238700 cd01409, SIRT4, SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
This region is characteristic of Silent information regulator 2 (Sir2) proteins, or sirtuins. These are protein deacetylases that depend on nicotine adenine dinucleotide (NAD). They are found in many subcellular locations, including the nucleus, cytoplasm and mitochondria. Eukaryotic forms play in important role in the regulation of transcriptional repression. Moreover, they are involved in microtubule organisation and DNA damage repair processes. Length = 177
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity.
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose
Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E
coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose
Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Also included in this superfamily is a group of uncharacterized Sir2-like proteins which lack certain key catalytic
This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes []. Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
>cd01406 SIR2-like Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor
It has been shown [] that some of these enzymes are structurally related. This central domain of TPP enzymes contains a 2-fold Rossman fold. ; GO: 0000287 magnesium ion binding, 0030976 thiamine pyrophosphate binding; PDB: 1OZH_C 1OZF_B 1OZG_B 2Q29_B 2Q28_A 2Q27_B 1OVM_B 1PVD_A 1PYD_B 2VK1_C ....
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only]
Score = 57.6 bits (140), Expect = 6e-12
Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 2/43 (4%)
Query: 37 LSEWIDKAKHVVLHTGAGISTSAGIPDFSGPH-YWRR-RVEEL 77
L + I ++K++V TGAG+S +GIP F G W R R EEL
Sbjct: 5 LLKTIAESKYLVALTGAGVSAESGIPTFRGKDGLWNRYRPEEL 47
