Psyllid ID: psy8980

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MDDRMHPVGIMGQQQAYGLDHGTPTPDLEPRKQDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGANAAASASAAASGGPGQPDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMGPSSQGTPTPMMSPAPPGGPQDSMGYSVNMNGDYSSPMSGYDS
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEEEccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHcccHccccccccccccccccccccccccccccccccccccccccccccccccccccc
mddrmhpvgimgqqqaygldhgtptpdleprkQDIGEILQQIMNITDQCLDEAQARKHtlnchrmkpsLFSVLCEIKEKTVLSLRntqeeeppdpqlmrlDNMLIaegvagpekggganaaasasaaasggpgqpdnaiehsDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREqsrtrpitpkEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYshlsnpypseeaKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKkaagaspysmgpssqgtptpmmspappggpqdsmgysvnmngdysspmsgyds
MDDRMHPVGIMGqqqaygldhGTPTPDLEPRKQDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVLSlrntqeeeppdpqlmrLDNMLIAEGVAGPEKGGGANAAASASAAASGGPGQPDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLreqsrtrpitpkEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITvsqvsnwfgnkrIRYKKNIGKAQEEANLYAAKKAAGASPYSMGPSSQGTPTPMMSPAPPGGPQDSMGYSVNMNGdysspmsgyds
MDDRMHPVGIMGQQQAYGLDHGTPTPDLEPRKQDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKggganaaasasaaasggPGQPDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANLYaakkaagaSPYSMGPSSQGTPTPMMSPAPPGGPQDSMGYSVNMNGDYSSPMSGYDS
**********************************IGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVL*************************************************************YRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLRE******ITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARR********ASEILNEYFYSHL************LARKCNITVSQVSNWFGNKRIRYKKNIG*****************************************************************
**************************************************************HRMKPSLFSVLCEIKEKTV****************************************************************AKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRT********************************************************EILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIR***********************************************************************
MDDRMHPVGIMGQQQAYGLDHGTPTPDLEPRKQDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVLSL********PDPQLMRLDNMLIAEGVAGPE*********************PDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPY**********RKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAK****************************GPQDSMGYSVNMNGDYS********
********************************QDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGP**************************IEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKK**********************************YS****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDRMHPVGIMGQQQAYGLDHGTPTPDLEPRKQDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGANAAASASAAASGGPGQPDNAIEHSDYRAKLAQIRQIYHQExxxxxxxxxxxxxxxxxxxxxQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMGPSSQGTPTPMMSPAPPGGPQDSMGYSVNMNGDYSSPMSGYDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query355 2.2.26 [Sep-21-2011]
Q7PMT1362 Homeobox protein extraden yes N/A 0.923 0.906 0.843 1e-161
Q29CT2376 Homeobox protein extraden yes N/A 0.974 0.920 0.825 1e-156
P40427376 Homeobox protein extraden yes N/A 0.971 0.917 0.823 1e-155
B3DM47422 Pre-B-cell leukemia trans yes N/A 0.915 0.770 0.763 1e-136
Q6IR52445 Pre-B-cell leukemia trans N/A N/A 0.909 0.725 0.753 1e-136
P41778430 Pre-B-cell leukemia trans yes N/A 0.814 0.672 0.828 1e-135
P40424430 Pre-B-cell leukemia trans yes N/A 0.814 0.672 0.828 1e-135
Q8QGC4347 Pre-B-cell leukemia trans N/A N/A 0.833 0.853 0.813 1e-135
B4F6V6347 Pre-B-cell leukemia trans no N/A 0.833 0.853 0.813 1e-135
P40425430 Pre-B-cell leukemia trans no N/A 0.884 0.730 0.755 1e-134
>sp|Q7PMT1|EXD_ANOGA Homeobox protein extradenticle OS=Anopheles gambiae GN=exd PE=3 SV=2 Back     alignment and function desciption
 Score =  568 bits (1464), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 286/339 (84%), Positives = 296/339 (87%), Gaps = 11/339 (3%)

Query: 17  YGL--DHGTPTPDLEPRKQDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLC 74
           YG+  + G    D +PRKQDIGEILQQIMNITDQ LDEAQARKHTLNCHRMKP LF+VLC
Sbjct: 19  YGMPTNDGQAGVDNDPRKQDIGEILQQIMNITDQSLDEAQARKHTLNCHRMKPVLFAVLC 78

Query: 75  EIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGANAAASASAAASGGPGQ 134
           EIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGA+  + +        G 
Sbjct: 79  EIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGADFLSQSDLT-----GG 133

Query: 135 PDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERM 194
            DNAIEHSDYRAKLAQIRQIYHQELEKYEQAC+EFTTHVMNLLREQSRTRPITPKEIERM
Sbjct: 134 QDNAIEHSDYRAKLAQIRQIYHQELEKYEQACSEFTTHVMNLLREQSRTRPITPKEIERM 193

Query: 195 VQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPY 254
           VQIIH+KFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPY
Sbjct: 194 VQIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPY 253

Query: 255 PSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMGP 314
           PSEEAKEELARKC ITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMG 
Sbjct: 254 PSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMGG 313

Query: 315 SSQGTPTPMMSPAPPGGPQDSMGYSVNMNG-DYSSPMSG 352
              G  TPMMSPAP    QDSMGYS+   G D   P  G
Sbjct: 314 PPSGAATPMMSPAP---AQDSMGYSLGSGGYDQQQPYDG 349
Transcription factor which acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless (wg), teashirt (tsh) and decapentaplegic (dpp), thus affecting segmental identity.
Anopheles gambiae (taxid: 7165)
>sp|Q29CT2|EXD_DROPS Homeobox protein extradenticle OS=Drosophila pseudoobscura pseudoobscura GN=exd PE=3 SV=1 Back     alignment and function description
>sp|P40427|EXD_DROME Homeobox protein extradenticle OS=Drosophila melanogaster GN=exd PE=1 SV=1 Back     alignment and function description
>sp|B3DM47|PBX2_XENTR Pre-B-cell leukemia transcription factor 2 OS=Xenopus tropicalis GN=pbx2 PE=2 SV=1 Back     alignment and function description
>sp|Q6IR52|PBX2_XENLA Pre-B-cell leukemia transcription factor 2 OS=Xenopus laevis GN=pbx2 PE=2 SV=1 Back     alignment and function description
>sp|P41778|PBX1_MOUSE Pre-B-cell leukemia transcription factor 1 OS=Mus musculus GN=Pbx1 PE=1 SV=2 Back     alignment and function description
>sp|P40424|PBX1_HUMAN Pre-B-cell leukemia transcription factor 1 OS=Homo sapiens GN=PBX1 PE=1 SV=1 Back     alignment and function description
>sp|Q8QGC4|PBX1_XENLA Pre-B-cell leukemia transcription factor 1 OS=Xenopus laevis GN=pbx1 PE=1 SV=1 Back     alignment and function description
>sp|B4F6V6|PBX1_XENTR Pre-B-cell leukemia transcription factor 1 OS=Xenopus tropicalis GN=pbx1 PE=2 SV=1 Back     alignment and function description
>sp|P40425|PBX2_HUMAN Pre-B-cell leukemia transcription factor 2 OS=Homo sapiens GN=PBX2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query355
193709272425 PREDICTED: homeobox protein extradenticl 0.977 0.816 0.912 1e-176
297381069391 extradenticle [Polyrhachis vicina] 0.921 0.836 0.927 1e-165
345479978402 PREDICTED: homeobox protein extradenticl 0.907 0.800 0.932 1e-164
345479976390 PREDICTED: homeobox protein extradenticl 0.907 0.825 0.932 1e-164
383848530431 PREDICTED: homeobox protein extradenticl 0.921 0.758 0.915 1e-163
340711688423 PREDICTED: homeobox protein extradenticl 0.921 0.773 0.918 1e-161
328776690420 PREDICTED: homeobox protein extradenticl 0.921 0.778 0.913 1e-161
350416158432 PREDICTED: homeobox protein extradenticl 0.921 0.756 0.907 1e-160
158298056362 AGAP004696-PA [Anopheles gambiae str. PE 0.923 0.906 0.843 1e-159
86515348361 extradenticle [Tribolium castaneum] gi|3 0.887 0.872 0.903 1e-157
>gi|193709272|ref|XP_001948220.1| PREDICTED: homeobox protein extradenticle-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 324/355 (91%), Positives = 335/355 (94%), Gaps = 8/355 (2%)

Query: 5   MHPVGIMGQQQAYGL-----DHGTPTP-DLEPRKQDIGEILQQIMNITDQCLDEAQARKH 58
           MHP   M   Q YG+     +HG PTP D + RKQDIGEILQQIMNITDQ LDEAQARKH
Sbjct: 11  MHPTSAM-LPQPYGMSSVDPNHGAPTPPDQDTRKQDIGEILQQIMNITDQSLDEAQARKH 69

Query: 59  TLNCHRMKPSLFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGA 118
           TLNCHRMKPSLFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGA
Sbjct: 70  TLNCHRMKPSLFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGA 129

Query: 119 NAAASASAAASGGPGQPDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLR 178
            AAASASAAASGGPGQPDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLR
Sbjct: 130 GAAASASAAASGGPGQPDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLR 189

Query: 179 EQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQA 238
           EQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQA
Sbjct: 190 EQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQA 249

Query: 239 SEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANL 298
           SEILNEYFYSHLSNPYPSEEAKEELARKC+ITVSQVSNWFGNKRIRYKKNIGKAQEEANL
Sbjct: 250 SEILNEYFYSHLSNPYPSEEAKEELARKCSITVSQVSNWFGNKRIRYKKNIGKAQEEANL 309

Query: 299 YAAKKAAGASPYSMGPSSQGTPTPMMSPAPPGGPQDSMGYSVNMNG-DYSSPMSG 352
           YAAKKAAGASPYSMGP+SQGTPTP++SPAP GGPQDSMGYS+++NG +YSSPMSG
Sbjct: 310 YAAKKAAGASPYSMGPASQGTPTPLLSPAPGGGPQDSMGYSLSLNGAEYSSPMSG 364

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|297381069|gb|ADI39642.1| extradenticle [Polyrhachis vicina] Back     alignment and taxonomy information
>gi|345479978|ref|XP_003424066.1| PREDICTED: homeobox protein extradenticle-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345479976|ref|XP_001604911.2| PREDICTED: homeobox protein extradenticle-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383848530|ref|XP_003699902.1| PREDICTED: homeobox protein extradenticle-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340711688|ref|XP_003394403.1| PREDICTED: homeobox protein extradenticle-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328776690|ref|XP_392297.4| PREDICTED: homeobox protein extradenticle [Apis mellifera] Back     alignment and taxonomy information
>gi|350416158|ref|XP_003490861.1| PREDICTED: homeobox protein extradenticle-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|158298056|ref|XP_318146.2| AGAP004696-PA [Anopheles gambiae str. PEST] gi|190359338|sp|Q7PMT1.2|EXD_ANOGA RecName: Full=Homeobox protein extradenticle gi|157014624|gb|EAA13242.3| AGAP004696-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|86515348|ref|NP_001034501.1| extradenticle [Tribolium castaneum] gi|38490515|emb|CAD57734.1| extradenticle [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query355
UNIPROTKB|Q7PMT1362 exd "Homeobox protein extraden 0.946 0.928 0.797 2.4e-138
UNIPROTKB|Q29CT2376 exd "Homeobox protein extraden 0.985 0.930 0.770 5.1e-138
FB|FBgn0000611376 exd "extradenticle" [Drosophil 0.983 0.928 0.771 6.5e-138
UNIPROTKB|B3DM47422 pbx2 "Pre-B-cell leukemia tran 0.935 0.786 0.724 1.9e-122
UNIPROTKB|Q6IR52445 pbx2 "Pre-B-cell leukemia tran 0.904 0.721 0.725 5.1e-122
UNIPROTKB|P40426434 PBX3 "Pre-B-cell leukemia tran 0.895 0.732 0.726 7.4e-122
ZFIN|ZDB-GENE-000405-1428 pbx1a "pre-B-cell leukemia tra 0.971 0.806 0.696 2.8e-121
UNIPROTKB|F1P3W1433 PBX3 "Uncharacterized protein" 0.895 0.734 0.723 8.4e-121
ZFIN|ZDB-GENE-000405-3403 pbx3b "pre-B-cell leukemia tra 0.892 0.786 0.730 4.1e-120
MGI|MGI:97496434 Pbx3 "pre B cell leukemia home 0.895 0.732 0.726 5.2e-120
UNIPROTKB|Q7PMT1 exd "Homeobox protein extradenticle" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
 Score = 1354 (481.7 bits), Expect = 2.4e-138, P = 2.4e-138
 Identities = 275/345 (79%), Positives = 282/345 (81%)

Query:     9 GIMGQQQAYGLDHGTPTPDLEPRKQDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPS 68
             G+M        + G    D +PRKQDIGEILQQIMNITDQ LDEAQARKHTLNCHRMKP 
Sbjct:    13 GLMPPNYGMPTNDGQAGVDNDPRKQDIGEILQQIMNITDQSLDEAQARKHTLNCHRMKPV 72

Query:    69 LFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKXXXXXXXXXXXXXX 128
             LF+VLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEK              
Sbjct:    73 LFAVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGADFLSQSDLTG 132

Query:   129 XXXPGQPDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITP 188
                 GQ DNAIEHSDYRAKLAQIRQIYHQELEKYEQAC+EFTTHVMNLLREQSRTRPITP
Sbjct:   133 ----GQ-DNAIEHSDYRAKLAQIRQIYHQELEKYEQACSEFTTHVMNLLREQSRTRPITP 187

Query:   189 KEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYS 248
             KEIERMVQIIH+KFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYS
Sbjct:   188 KEIERMVQIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYS 247

Query:   249 HLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANLYXXXXXXXXS 308
             HLSNPYPSEEAKEELARKC ITVSQVSNWFGNKRIRYKKNIGKAQEEANLY        S
Sbjct:   248 HLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGAS 307

Query:   309 PYSMGPSSQGTPTPMMSPAPPGGPQDSMGYSVNMNG-DYSSPMSG 352
             PYSMG    G  TPMMSPAP    QDSMGYS+   G D   P  G
Sbjct:   308 PYSMGGPPSGAATPMMSPAPA---QDSMGYSLGSGGYDQQQPYDG 349
GO:0000060 "protein import into nucleus, translocation" evidence=ISS
GO:0001654 "eye development" evidence=ISS
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005667 "transcription factor complex" evidence=ISS
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0007422 "peripheral nervous system development" evidence=ISS
UNIPROTKB|Q29CT2 exd "Homeobox protein extradenticle" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
FB|FBgn0000611 exd "extradenticle" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3DM47 pbx2 "Pre-B-cell leukemia transcription factor 2" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q6IR52 pbx2 "Pre-B-cell leukemia transcription factor 2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|P40426 PBX3 "Pre-B-cell leukemia transcription factor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000405-1 pbx1a "pre-B-cell leukemia transcription factor 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3W1 PBX3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000405-3 pbx3b "pre-B-cell leukemia transcription factor 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:97496 Pbx3 "pre B cell leukemia homeobox 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B3DM47PBX2_XENTRNo assigned EC number0.76340.91540.7701yesN/A
Q8QGC4PBX1_XENLANo assigned EC number0.81390.83380.8530N/AN/A
Q7PMT1EXD_ANOGANo assigned EC number0.84360.92390.9060yesN/A
Q6IR52PBX2_XENLANo assigned EC number0.75370.90980.7258N/AN/A
Q29CT2EXD_DROPSNo assigned EC number0.82540.97460.9202yesN/A
O35317PBX3_MOUSENo assigned EC number0.83680.78590.6428noN/A
P41779HM20_CAEELNo assigned EC number0.65050.75210.7899yesN/A
P41778PBX1_MOUSENo assigned EC number0.82810.81400.6720yesN/A
O35984PBX2_MOUSENo assigned EC number0.75540.88450.7302noN/A
Q9BYU1PBX4_HUMANNo assigned EC number0.76830.76330.7245noN/A
P40424PBX1_HUMANNo assigned EC number0.82810.81400.6720yesN/A
P40425PBX2_HUMANNo assigned EC number0.75540.88450.7302noN/A
P40426PBX3_HUMANNo assigned EC number0.83680.78590.6428noN/A
P40427EXD_DROMENo assigned EC number0.82320.97180.9175yesN/A
B4F6V6PBX1_XENTRNo assigned EC number0.81390.83380.8530noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query355
pfam03792192 pfam03792, PBC, PBC domain 1e-116
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 7e-18
pfam0004657 pfam00046, Homeobox, Homeobox domain 3e-16
smart0038957 smart00389, HOX, Homeodomain 7e-16
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 1e-15
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 5e-07
>gnl|CDD|217730 pfam03792, PBC, PBC domain Back     alignment and domain information 
 Score =  335 bits (860), Expect = e-116
 Identities = 149/197 (75%), Positives = 165/197 (83%), Gaps = 8/197 (4%)

Query: 30  PRKQDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVLSLRNTQE 89
            R QDI ++LQQIM ITDQ LDEAQARKH LNCHRMKP+LFSVLCEIKEKT LS RN  E
Sbjct: 4   QRSQDISDLLQQIMKITDQSLDEAQARKHALNCHRMKPALFSVLCEIKEKTALSTRNMPE 63

Query: 90  EEPPDPQLMRLDNMLIAEGVAGPEKGGGANAAASASAAASGGPGQPDNAIEHSDYRAKLA 149
           ++PPDPQL+RLDNML+AEGVAGP+K G   AAA+ +         PDN+IEHSDYRAKL+
Sbjct: 64  DDPPDPQLLRLDNMLLAEGVAGPDKSGLLAAAAAGTG--------PDNSIEHSDYRAKLS 115

Query: 150 QIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQL 209
           QIRQIYH ELEKYEQAC EFT HVMNLLREQSRTRPI+ +EIERMV II +KF+ IQ QL
Sbjct: 116 QIRQIYHSELEKYEQACKEFTQHVMNLLREQSRTRPISQREIERMVNIISRKFNKIQFQL 175

Query: 210 KQSTCEAVMILRSRFLD 226
           KQSTCEAVMILRSRFLD
Sbjct: 176 KQSTCEAVMILRSRFLD 192

The PBC domain is a member of the TALE (three-amino-acid loop extension) superclass of homeodomain proteins. Length = 192
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 355
KOG0774|consensus334 100.0
PF03792191 PBC: PBC domain; InterPro: IPR005542 Pbx proteins 100.0
KOG3802|consensus398 99.71
KOG0775|consensus304 99.66
KOG0484|consensus125 99.6
KOG0488|consensus309 99.53
KOG0485|consensus268 99.52
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.5
KOG0850|consensus245 99.48
KOG0489|consensus261 99.47
KOG0842|consensus307 99.47
KOG0843|consensus197 99.47
KOG0487|consensus308 99.43
KOG0492|consensus246 99.42
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.41
KOG1168|consensus385 99.4
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.4
KOG2251|consensus228 99.38
KOG0848|consensus317 99.38
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.31
KOG0494|consensus332 99.27
KOG0493|consensus342 99.24
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.24
KOG0491|consensus194 99.21
KOG0486|consensus 351 99.16
KOG0773|consensus342 99.15
COG5576156 Homeodomain-containing transcription factor [Trans 99.13
KOG0483|consensus198 99.13
KOG4577|consensus383 99.05
KOG0844|consensus 408 99.04
KOG0847|consensus288 98.95
KOG0490|consensus235 98.73
KOG0849|consensus354 98.54
PF0379045 KNOX1: KNOX1 domain ; InterPro: IPR005540 The MEIN 98.37
KOG2252|consensus558 98.12
KOG0490|consensus235 97.3
PF0379152 KNOX2: KNOX2 domain ; InterPro: IPR005541 The MEIN 97.15
KOG1146|consensus 1406 96.62
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.52
KOG0773|consensus 342 95.66
KOG3623|consensus 1007 90.34
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 88.45
>KOG0774|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.6e-79  Score=561.72  Aligned_cols=266  Identities=88%  Similarity=1.292  Sum_probs=253.1

Q ss_pred             CcHHHHHHHHHhhcccCchHHHHHHhhhhcCCChhHHHHHHHHhhhcccccccCCCCCCCCCchhhhhhhHHhhhcccCC
Q psy8980          33 QDIGEILQQIMNITDQCLDEAQARKHTLNCHRMKPSLFSVLCEIKEKTVLSLRNTQEEEPPDPQLMRLDNMLIAEGVAGP  112 (355)
Q Consensus        33 ~~~~~~~~~~~~~~~~~ld~~~~~k~~i~~Hpl~p~L~~~~~e~~e~~~~s~~~~~~e~~~d~q~~rldn~l~~~~v~~~  112 (355)
                      +||+|||||||+|||||||||+++||+|+||||||+||+||||+||||++|+|+.++|+|+|||++||||||.||||+||
T Consensus         8 ~di~diL~qim~ItdqslDeaqa~K~~lnch~mk~AlfsVLcE~KeKt~lsir~~qdeep~dpqlmRLDnML~AEGVagP   87 (334)
T KOG0774|consen    8 KDIGDILQQIMKITDQSLDEAQARKHALNCHRMKPALFSVLCEIKEKTVLSIRGMQDEEPPDPQLMRLDNMLLAEGVAGP   87 (334)
T ss_pred             hhHHHHHHHHHHhhhhccchHHhhhhccccccchHHHHHHHHHhhhhheeeeccccccCCCChHHHHHHHHHHHhcccCc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCchhHhhHhhhhCCCCCCCCCcccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCHHHHH
Q psy8980         113 EKGGGANAAASASAAASGGPGQPDNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIE  192 (355)
Q Consensus       113 ~~~~~~~~~a~a~~~~~~~~~~~dn~~e~~~~~~kL~qvl~~y~~eLeky~~~~~~f~~~~i~ll~~qs~~~pls~~~~~  192 (355)
                      +++|...     ++| +++    |    |.||+.||.||+++|+.||+||++.|++||++++++|++|+++||+.+++++
T Consensus        88 ekgga~~-----~~A-sgg----~----hsdYR~kL~qiR~iy~~ElekyeqaCneftthV~nlL~eQsr~RPi~~ke~e  153 (334)
T KOG0774|consen   88 EKGGARA-----AAA-SGG----D----HSDYRAKLLQIRQIYHNELEKYEQACNEFTTHVMNLLREQSRTRPIMPKEIE  153 (334)
T ss_pred             cccchhh-----hhc-cCC----C----hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCHHHHH
Confidence            9998332     111 222    1    7899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhhHHHHHhhhhhHHHHHhhhhhhcccCCCCcCCCHHHHHHHHHHhhhcCCCCCCCHHHHHHHHHHcCCCcc
Q psy8980         193 RMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVS  272 (355)
Q Consensus       193 ~~~~~~~~~f~~~~~~lk~~~~~~~~~l~~~~~~~rr~R~~fs~~q~~~L~~~F~~H~~~pyPs~~er~~LA~~~gLt~~  272 (355)
                      +++++|+++|+.++.+||+++|++++.|++++.+.||||++|++..+.+|..||+.|..||||++++|++||++|+++..
T Consensus       154 ~m~~~i~~kF~~iq~~lkqstce~vmiLr~r~ldarRKRRNFsK~aTeiLneyF~~h~~nPYPSee~K~eLAkqCnItvs  233 (334)
T KOG0774|consen  154 RMVQIISKKFSHIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKQCNITVS  233 (334)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHhcCCCCCcHHHHHHHHHHcCceeh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccchhhhhhhhhhhhhHHHhHHHHhhhcCCCCCCC
Q psy8980         273 QVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSM  312 (355)
Q Consensus       273 qV~~WFqNrR~R~Kk~~~~~~~e~~~~~~~~~~~~~~~s~  312 (355)
                      ||.|||.|+|.|+||...+.+++++.++.+.++..++.+.
T Consensus       234 QvsnwfgnkrIrykK~~~k~~ee~~l~~~kk~~~~~~~g~  273 (334)
T KOG0774|consen  234 QVSNWFGNKRIRYKKNMGKNQEEANLYAAKKAVDATPPGA  273 (334)
T ss_pred             hhccccccceeehhhhhhhhhhhhhhHhhcccccCCCCCC
Confidence            9999999999999999999999999999999887666333

>PF03792 PBC: PBC domain; InterPro: IPR005542 Pbx proteins are members of the TALE (three-amino-acid loop extension) family of atypical homeodomain proteins, whose members are characterised by a three-residue insertion in the first helix of the homeodomain involved in their interaction with Hox proteins Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>PF03790 KNOX1: KNOX1 domain ; InterPro: IPR005540 The MEINOX region is comprised of two domains, KNOX1 and KNOX2 Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF03791 KNOX2: KNOX2 domain ; InterPro: IPR005541 The MEINOX region is comprised of two domains, KNOX1 and KNOX2 Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query355
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 2e-33
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 1e-32
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 9e-32
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 6e-31
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 5e-25
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 5e-08
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 9e-08
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 4e-07
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 5e-06
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 1e-05
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure 
Iteration: 1

 Score =  139 bits (351), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/73 (91%), Positives = 71/73 (97%)
Query: 227 ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYK 286
           ARRKRRNF+KQA+EILNEYFYSHLSNPYPSEEAKEELA+KC ITVSQVSNWFGNKRIRYK
Sbjct: 1   ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 60
Query: 287 KNIGKAQEEANLY 299
           KNIGK QEEAN+Y
Sbjct: 61  KNIGKFQEEANIY 73
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query355
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 6e-37
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 3e-35
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 5e-31
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 8e-25
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 3e-24
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 3e-24
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 4e-24
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 9e-24
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 2e-23
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 7e-23
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 8e-18
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-14
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 5e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-11
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-11
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-09
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-09
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 4e-09
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 4e-09
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 4e-09
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-09
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-08
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-08
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-08
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-08
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 6e-08
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 8e-08
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-07
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 3e-07
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-07
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 4e-07
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 8e-07
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 8e-07
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-06
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-06
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-06
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-06
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-06
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-06
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 4e-06
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 7e-06
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 7e-06
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 3e-05
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 5e-05
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 5e-05
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-05
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 7e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 7e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 1e-04
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 1e-04
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-04
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-04
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 2e-04
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-04
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 3e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 3e-04
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 4e-04
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 5e-04
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 5e-04
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 6e-04
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-04
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
 Score =  127 bits (321), Expect = 6e-37
 Identities = 73/85 (85%), Positives = 78/85 (91%)

Query: 227 ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYK 286
           ARRKRRNF+KQA+EILNEYFYSHLSNPYPSEEAKEELA+KC ITVSQVSNWFGNKRIRYK
Sbjct: 1   ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 60

Query: 287 KNIGKAQEEANLYAAKKAAGASPYS 311
           KNIGK QEEAN+YAAK A  A+  S
Sbjct: 61  KNIGKFQEEANIYAAKTAVTATNVS 85
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query355
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.75
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.75
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.73
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.71
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.71
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.69
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.66
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.66
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.65
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.65
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.64
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.64
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.64
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.63
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.63
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.63
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.63
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.63
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.63
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.63
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.63
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.63
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.62
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.62
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.62
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.62
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.62
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.62
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.62
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.62
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.62
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.61
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.61
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.61
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.61
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.61
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.61
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.61
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.61
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.61
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.6
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.6
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.6
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.6
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.6
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.59
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.59
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.59
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.59
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.58
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.58
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.58
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.57
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.57
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.57
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.57
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.56
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.56
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.55
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.55
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.55
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.55
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.54
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.53
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.5
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.48
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.48
2e19_A64 Transcription factor 8; homeobox domain, structura 99.46
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.46
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.44
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.43
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.43
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.37
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.21
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.17
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.15
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.03
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.29
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 93.56
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
Probab=99.75  E-value=5.1e-19  Score=139.85  Aligned_cols=70  Identities=93%  Similarity=1.382  Sum_probs=64.7

Q ss_pred             CCCCcCCCHHHHHHHHHHhhhcCCCCCCCHHHHHHHHHHcCCCcccccccccchhhhhhhhhhhhhHHHh
Q psy8980         228 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEAN  297 (355)
Q Consensus       228 rr~R~~fs~~q~~~L~~~F~~H~~~pyPs~~er~~LA~~~gLt~~qV~~WFqNrR~R~Kk~~~~~~~e~~  297 (355)
                      ||+|+.|+..++.+|+.||..|..++||+..++..||..+||++.||+|||||+|+|+|+...+...++.
T Consensus         2 rr~R~~ft~~q~~~Le~~f~~h~~~~yp~~~~r~~La~~~~l~~~qV~~WFqNrR~r~kk~~~~~~~~~~   71 (87)
T 1b72_B            2 RRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEAN   71 (87)
T ss_dssp             -CCCCCCCHHHHHHHHHHHHTTTTSCCCCHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHCGGGGHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhccCCCCCHHHHHHHHHHHCcCHHHHHHHHHHHHHHhhhcccccccccc
Confidence            6789999999999999999999999999999999999999999999999999999999999877665544
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 355
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 5e-24
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-21
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-18
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 4e-13
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 6e-13
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-12
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-12
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-12
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 3e-12
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 8e-12
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-11
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-11
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-11
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 6e-11
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 7e-11
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 8e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-10
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-10
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-10
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-10
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-10
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 5e-10
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 7e-10
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 3e-09
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 8e-09
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-07
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 5e-06
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: pbx1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 91.6 bits (227), Expect = 5e-24
 Identities = 67/73 (91%), Positives = 71/73 (97%)

Query: 227 ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYK 286
           ARRKRRNF+KQA+EILNEYFYSHLSNPYPSEEAKEELA+KC ITVSQVSNWFGNKRIRYK
Sbjct: 1   ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 60

Query: 287 KNIGKAQEEANLY 299
           KNIGK QEEAN+Y
Sbjct: 61  KNIGKFQEEANIY 73
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query355
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.72
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.71
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.69
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.69
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.69
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.68
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.68
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.68
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.67
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.67
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.66
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.65
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.65
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.65
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.65
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.64
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.64
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.63
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.63
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.62
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.62
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.61
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.6
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.59
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.54
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.54
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.51
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.5
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.47
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.47
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.43
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: pbx1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=5.1e-20  Score=139.57  Aligned_cols=71  Identities=92%  Similarity=1.376  Sum_probs=65.5

Q ss_pred             CCCCcCCCHHHHHHHHHHhhhcCCCCCCCHHHHHHHHHHcCCCcccccccccchhhhhhhhhhhhhHHHhH
Q psy8980         228 RRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCNITVSQVSNWFGNKRIRYKKNIGKAQEEANL  298 (355)
Q Consensus       228 rr~R~~fs~~q~~~L~~~F~~H~~~pyPs~~er~~LA~~~gLt~~qV~~WFqNrR~R~Kk~~~~~~~e~~~  298 (355)
                      ||+|+.|+++++.+|+.||.+|..+|||+..++..||..+||+..||+|||+|+|+|.|+...+..++++.
T Consensus         2 rk~R~~~t~~q~~~Le~~f~~~~~~pYPs~~~k~~La~~~gl~~~qv~~WF~N~R~r~k~~~~~~~~~~n~   72 (73)
T d1pufb_           2 RRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANI   72 (73)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHTTTSCCCCHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHCTTTTTTHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHCcCHHHhHHHHHHHHHHhcccchhhHhhcCC
Confidence            67899999999999999999999999999999999999999999999999999999999987766665543
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure