Diaphorina citri psyllid: psy9004


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MRTNGFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEIRY
ccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccHHHHHHHcccccccc
******G**EQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTNGFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEIRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1,4-alpha-glucan-branching enzyme Required for sufficient glycogen accumulation. The alpha 1-6 branches of glycogen play an important role in increasing the solubility of the molecule and, consequently, in reducing the osmotic pressure within cells.confidentQ04446
1,4-alpha-glucan-branching enzyme Required for sufficient glycogen accumulation. The alpha 1-6 branches of glycogen play an important role in increasing the solubility of the molecule and, consequently, in reducing the osmotic pressure within cells.confidentQ9D6Y9
1,4-alpha-glucan-branching enzyme Required for sufficient glycogen accumulation. The alpha 1-6 branches of glycogen play an important role in increasing the solubility of the molecule and, consequently, in reducing the osmotic pressure within cells.confidentQ6EAS5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003844 [MF]1,4-alpha-glucan branching enzyme activityprobableGO:0016758, GO:0016740, GO:0003674, GO:0016757, GO:0003824
GO:0030246 [MF]carbohydrate bindingprobableGO:0003674, GO:0005488
GO:0005978 [BP]glycogen biosynthetic processprobableGO:0044249, GO:0009250, GO:0034645, GO:0006091, GO:0016051, GO:1901576, GO:0044264, GO:0044262, GO:0044260, GO:0071704, GO:0006112, GO:0006073, GO:0043170, GO:0009987, GO:0000271, GO:0044710, GO:0034637, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0044723, GO:0055114, GO:0044042, GO:0044238, GO:0005975, GO:0015980, GO:0005977, GO:0005976, GO:0044237, GO:0033692
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004553 [MF]hydrolase activity, hydrolyzing O-glycosyl compoundsprobableGO:0016787, GO:0003674, GO:0016798, GO:0003824
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0043169 [MF]cation bindingprobableGO:0003674, GO:0005488, GO:0043167
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0006006 [BP]glucose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AML, chain A
Confidence level:very confident
Coverage over the Query: 2-227
View the alignment between query and template
View the model in PyMOL