Psyllid ID: psy9004

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MRTNGFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEIRY
ccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccHHHHHHHcccccccc
cccccccHHHHHHccccHEEEccccEccccccEEccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHHcccccccccccccccccccccccEEEcccHHHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccHHHHHHHHcccccccc
mrtngfgtpeQLKYLVDEChkaglfgtpeQLKYLVDEChkaglfgtpeQLKYLVDECHKAGLYVLLDVVHSHASknvldglnefdgtqacffhdgprgthplwdsrlfnySEIEVLRFLLSNLRWYLEEyqfdgfrfdgvtsmlyhnhgcgegfsghydeyfglnvdtDALIYLMVANKflhdkypeiITIAedvsgmpascrpvteggtgfdyrlgrpgldksfygnaslgleiry
mrtngfgtpeQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIaedvsgmpaSCRPVTEGGTGFdyrlgrpgldksfygnaslgleiry
MRTNGFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEIRY
**********QLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNA********
******G**EQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEI**
MRTNGFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEIRY
**TNGFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEIR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTNGFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYGNASLGLEIRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query237 2.2.26 [Sep-21-2011]
Q9D6Y9 702 1,4-alpha-glucan-branchin yes N/A 0.759 0.256 0.727 2e-72
Q04446 702 1,4-alpha-glucan-branchin yes N/A 0.759 0.256 0.705 1e-71
Q6T308 699 1,4-alpha-glucan-branchin N/A N/A 0.759 0.257 0.716 1e-71
Q6EAS5 699 1,4-alpha-glucan-branchin yes N/A 0.759 0.257 0.716 4e-71
P0CN82 682 1,4-alpha-glucan-branchin yes N/A 0.729 0.253 0.682 5e-67
P0CN83 682 1,4-alpha-glucan-branchin N/A N/A 0.729 0.253 0.682 5e-67
Q8NKE1 683 1,4-alpha-glucan-branchin N/A N/A 0.734 0.254 0.689 1e-66
Q9LZS3 805 1,4-alpha-glucan-branchin yes N/A 0.755 0.222 0.659 5e-66
P30924 861 1,4-alpha-glucan-branchin N/A N/A 0.772 0.212 0.629 3e-64
Q96VA4 689 1,4-alpha-glucan-branchin yes N/A 0.734 0.252 0.689 3e-64
>sp|Q9D6Y9|GLGB_MOUSE 1,4-alpha-glucan-branching enzyme OS=Mus musculus GN=Gbe1 PE=2 SV=1 Back     alignment and function desciption
 Score =  272 bits (695), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 131/180 (72%), Positives = 145/180 (80%)

Query: 44  FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLW 103
           +GTPE+LK LVD  H  G+ VLLDVVHSHASKN  DGLN FDGT +C+FH GPRGTH LW
Sbjct: 263 YGTPEELKELVDTAHSMGIVVLLDVVHSHASKNSEDGLNMFDGTDSCYFHSGPRGTHDLW 322

Query: 104 DSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFG 163
           DSRLF YS  EVLRFLLSN+RW+LEEY FDGFRFDGVTSMLYH+HG G+GFSG Y+EYFG
Sbjct: 323 DSRLFIYSSWEVLRFLLSNIRWWLEEYCFDGFRFDGVTSMLYHHHGMGQGFSGDYNEYFG 382

Query: 164 LNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDK 223
           L VD DALIYLM+AN   H  YP+ ITIAEDVSGMPA C P ++GG GFDYRL     DK
Sbjct: 383 LQVDEDALIYLMLANHLAHTLYPDSITIAEDVSGMPALCSPTSQGGGGFDYRLAMAIPDK 442
Required for sufficient glycogen accumulation. The alpha 1-6 branches of glycogen play an important role in increasing the solubility of the molecule and, consequently, in reducing the osmotic pressure within cells.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 8
>sp|Q04446|GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens GN=GBE1 PE=1 SV=3 Back     alignment and function description
>sp|Q6T308|GLGB_FELCA 1,4-alpha-glucan-branching enzyme OS=Felis catus GN=GBE1 PE=2 SV=1 Back     alignment and function description
>sp|Q6EAS5|GLGB_HORSE 1,4-alpha-glucan-branching enzyme OS=Equus caballus GN=GBE1 PE=2 SV=1 Back     alignment and function description
>sp|P0CN82|GLGB_CRYNJ 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GLC3 PE=3 SV=1 Back     alignment and function description
>sp|P0CN83|GLGB_CRYNB 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GLC3 PE=3 SV=1 Back     alignment and function description
>sp|Q8NKE1|GLGB_GLOIN 1,4-alpha-glucan-branching enzyme OS=Glomus intraradices GN=GLC3 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZS3|GLGB2_ARATH 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE2.2 PE=1 SV=1 Back     alignment and function description
>sp|P30924|GLGB_SOLTU 1,4-alpha-glucan-branching enzyme OS=Solanum tuberosum GN=SBE1 PE=2 SV=2 Back     alignment and function description
>sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gbeA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
307197707 596 1,4-alpha-glucan-branching enzyme [Harpe 0.759 0.302 0.761 3e-77
322785359 691 hypothetical protein SINV_12923 [Solenop 0.772 0.264 0.743 3e-76
332023850 697 1,4-alpha-glucan-branching enzyme [Acrom 0.772 0.262 0.743 3e-76
357604597 678 putative 1,4-alpha-glucan branching enzy 0.734 0.256 0.793 4e-76
350410058 692 PREDICTED: 1,4-alpha-glucan-branching en 0.759 0.260 0.75 8e-76
383863554 692 PREDICTED: 1,4-alpha-glucan-branching en 0.759 0.260 0.744 3e-75
156548680 694 PREDICTED: 1,4-alpha-glucan-branching en 0.759 0.259 0.744 3e-75
321455046 696 hypothetical protein DAPPUDRAFT_302911 [ 0.759 0.258 0.766 3e-75
307180420 693 1,4-alpha-glucan-branching enzyme [Campo 0.759 0.259 0.738 6e-75
346472471 685 hypothetical protein [Amblyomma maculatu 0.746 0.258 0.740 7e-75
>gi|307197707|gb|EFN78864.1| 1,4-alpha-glucan-branching enzyme [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 151/180 (83%)

Query: 44  FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLW 103
           +GTPE+LK L+D  H+ GLYVLLDVVHSHASKN LDGLN FDGT ACFFH G RG HPLW
Sbjct: 257 YGTPEELKELIDVAHQHGLYVLLDVVHSHASKNTLDGLNMFDGTDACFFHSGCRGEHPLW 316

Query: 104 DSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFG 163
           DSRLFNY E EVLRFLLSNLRWY+EEY FDGFRFDG+TSMLYH+ G G+GFSGHYDEY+G
Sbjct: 317 DSRLFNYGEYEVLRFLLSNLRWYIEEYGFDGFRFDGITSMLYHSRGFGQGFSGHYDEYYG 376

Query: 164 LNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDK 223
           LNVD + ++YLM+AN  LHD YPE+ITIAEDVSGMP  CRPV EGG GFDYRL     DK
Sbjct: 377 LNVDVEGVVYLMIANHMLHDIYPEMITIAEDVSGMPGICRPVAEGGVGFDYRLAMAIPDK 436

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322785359|gb|EFZ12033.1| hypothetical protein SINV_12923 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332023850|gb|EGI64074.1| 1,4-alpha-glucan-branching enzyme [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357604597|gb|EHJ64251.1| putative 1,4-alpha-glucan branching enzyme [Danaus plexippus] Back     alignment and taxonomy information
>gi|350410058|ref|XP_003488932.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383863554|ref|XP_003707245.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156548680|ref|XP_001602425.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321455046|gb|EFX66191.1| hypothetical protein DAPPUDRAFT_302911 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307180420|gb|EFN68446.1| 1,4-alpha-glucan-branching enzyme [Camponotus floridanus] Back     alignment and taxonomy information
>gi|346472471|gb|AEO36080.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
FB|FBgn0053138 685 AGBE "1,4-Alpha-Glucan Branchi 0.759 0.262 0.738 2.6e-70
UNIPROTKB|F1PX32 699 GBE1 "Uncharacterized protein" 0.759 0.257 0.711 5.5e-70
MGI|MGI:1921435 702 Gbe1 "glucan (1,4-alpha-), bra 0.759 0.256 0.727 8.9e-70
RGD|1309968 536 Gbe1 "glucan (1,4-alpha-), bra 0.759 0.335 0.722 1.8e-69
ZFIN|ZDB-GENE-110914-16 630 si:ch211-247m23.1 "si:ch211-24 0.759 0.285 0.711 3.8e-69
UNIPROTKB|E9PGM4 661 GBE1 "1,4-alpha-glucan-branchi 0.759 0.272 0.705 6.3e-69
UNIPROTKB|Q04446 702 GBE1 "1,4-alpha-glucan-branchi 0.759 0.256 0.705 6.3e-69
UNIPROTKB|F1MZP0 655 GBE1 "Uncharacterized protein" 0.759 0.274 0.711 1.7e-68
ZFIN|ZDB-GENE-110411-171 688 si:ch211-213e17.1 "si:ch211-21 0.759 0.261 0.7 1.5e-67
UNIPROTKB|E1C303 588 GBE1 "Uncharacterized protein" 0.759 0.306 0.694 1.1e-66
FB|FBgn0053138 AGBE "1,4-Alpha-Glucan Branching Enzyme" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 712 (255.7 bits), Expect = 2.6e-70, P = 2.6e-70
 Identities = 133/180 (73%), Positives = 146/180 (81%)

Query:    44 FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLW 103
             +G PEQLK ++D  H  GL+VLLDVVHSHASKNV DGLN+FDGT +CFFHDG RG H LW
Sbjct:   248 YGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHDGARGEHSLW 307

Query:   104 DSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFG 163
             DSRLFNY E EVLRFLLSNLRW+ +EY FDG+RFDGVTSMLYH+ G GEGFSG Y+EYFG
Sbjct:   308 DSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSGDYNEYFG 367

Query:   164 LNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDK 223
             LNVDTDAL YL +AN  LH     IITIAEDVSGMP  CRPV+EGG GFDYRLG    DK
Sbjct:   368 LNVDTDALNYLGLANHLLHTIDSRIITIAEDVSGMPTLCRPVSEGGIGFDYRLGMAIPDK 427
GO:0003844 "1,4-alpha-glucan branching enzyme activity" evidence=ISS
GO:0005978 "glycogen biosynthetic process" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0008340 "determination of adult lifespan" evidence=IMP
UNIPROTKB|F1PX32 GBE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1921435 Gbe1 "glucan (1,4-alpha-), branching enzyme 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309968 Gbe1 "glucan (1,4-alpha-), branching enzyme 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-16 si:ch211-247m23.1 "si:ch211-247m23.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGM4 GBE1 "1,4-alpha-glucan-branching enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q04446 GBE1 "1,4-alpha-glucan-branching enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZP0 GBE1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110411-171 si:ch211-213e17.1 "si:ch211-213e17.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C303 GBE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q04446GLGB_HUMAN2, ., 4, ., 1, ., 1, 80.70550.75940.2564yesN/A
Q555Q9GLGB_DICDI2, ., 4, ., 1, ., 1, 80.61740.76370.2669yesN/A
Q96VA4GLGB_ASPOR2, ., 4, ., 1, ., 1, 80.68960.73410.2525yesN/A
Q6CCT1GLGB_YARLI2, ., 4, ., 1, ., 1, 80.6250.73410.2518yesN/A
Q6EAS5GLGB_HORSE2, ., 4, ., 1, ., 1, 80.71660.75940.2575yesN/A
Q6FJV0GLGB_CANGA2, ., 4, ., 1, ., 1, 80.61530.73410.2464yesN/A
Q9D6Y9GLGB_MOUSE2, ., 4, ., 1, ., 1, 80.72770.75940.2564yesN/A
P0CN82GLGB_CRYNJ2, ., 4, ., 1, ., 1, 80.68200.72990.2536yesN/A
Q6CX53GLGB_KLULA2, ., 4, ., 1, ., 1, 80.61080.74680.2461yesN/A
Q757Q6GLGB_ASHGO2, ., 4, ., 1, ., 1, 80.62430.73410.2475yesN/A
Q9Y8H3GLGB_EMENI2, ., 4, ., 1, ., 1, 80.67810.73410.2543yesN/A
P32775GLGB_YEAST2, ., 4, ., 1, ., 1, 80.60540.74680.2514yesN/A
Q6BXN1GLGB_DEBHA2, ., 4, ., 1, ., 1, 80.60100.74680.2489yesN/A
Q9LZS3GLGB2_ARATH2, ., 4, ., 1, ., 1, 80.65920.75520.2223yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
cd11321 406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 1e-124
PLN02447 758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 1e-107
PLN02960 897 PLN02960, PLN02960, alpha-amylase 3e-65
PLN03244 872 PLN03244, PLN03244, alpha-amylase; Provisional 4e-56
cd11322 402 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic dom 7e-45
COG0296 628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 5e-44
PRK12313 633 PRK12313, PRK12313, glycogen branching enzyme; Pro 5e-40
PRK05402 726 PRK05402, PRK05402, glycogen branching enzyme; Pro 3e-35
TIGR01515 618 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha 1e-33
PRK12568 730 PRK12568, PRK12568, glycogen branching enzyme; Pro 6e-28
PRK14705 1224 PRK14705, PRK14705, glycogen branching enzyme; Pro 8e-28
cd11325 436 cd11325, AmyAc_GTHase, Alpha amylase catalytic dom 2e-23
PRK14706 639 PRK14706, PRK14706, glycogen branching enzyme; Pro 2e-21
TIGR02402 544 TIGR02402, trehalose_TreZ, malto-oligosyltrehalose 1e-14
cd11350 390 cd11350, AmyAc_4, Alpha amylase catalytic domain f 1e-13
cd11313336 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly 4e-11
COG1523 697 COG1523, PulA, Type II secretory pathway, pullulan 3e-08
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 4e-08
cd11326 433 cd11326, AmyAc_Glg_debranch, Alpha amylase catalyt 9e-08
cd11319375 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic d 2e-07
TIGR02102 1111 TIGR02102, pullulan_Gpos, pullulanase, extracellul 2e-07
TIGR02104 605 TIGR02104, pulA_typeI, pullulanase, type I 2e-06
cd00551260 cd00551, AmyAc_family, Alpha amylase catalytic dom 1e-05
cd11352 443 cd11352, AmyAc_5, Alpha amylase catalytic domain f 2e-05
smart00642166 smart00642, Aamy, Alpha-amylase domain 3e-05
TIGR02100 688 TIGR02100, glgX_debranch, glycogen debranching enz 4e-05
PRK09505 683 PRK09505, malS, alpha-amylase; Reviewed 8e-05
cd11315352 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic 1e-04
PRK03705 658 PRK03705, PRK03705, glycogen debranching enzyme; P 2e-04
cd11348 429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 3e-04
cd11341 406 cd11341, AmyAc_Pullulanase_LD-like, Alpha amylase 3e-04
COG0366 505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 3e-04
cd11314302 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase 3e-04
cd11316 403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 3e-04
cd11340 407 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal 0.001
cd11330 472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 0.001
cd11332 481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 0.002
cd11331 450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 0.003
cd11354357 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalyt 0.003
TIGR02103 898 TIGR02103, pullul_strch, alpha-1,6-glucosidases, p 0.004
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information 
 Score =  356 bits (917), Expect = e-124
 Identities = 135/174 (77%), Positives = 147/174 (84%)

Query: 44  FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLW 103
           FGTPE LKYL+D  H  G+ VLLDVVHSHASKNVLDGLN FDGT  C+FH+G RG HPLW
Sbjct: 84  FGTPEDLKYLIDTAHGMGIAVLLDVVHSHASKNVLDGLNMFDGTDGCYFHEGERGNHPLW 143

Query: 104 DSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFG 163
           DSRLFNY + EVLRFLLSNLRW+LEEY+FDGFRFDGVTSMLYH+HG G GFSG Y EYFG
Sbjct: 144 DSRLFNYGKWEVLRFLLSNLRWWLEEYRFDGFRFDGVTSMLYHHHGLGTGFSGDYGEYFG 203

Query: 164 LNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLG 217
           LNVD DAL+YLM+AN  LH+ YP  ITIAEDVSGMP  CRPV+EGG GFDYRL 
Sbjct: 204 LNVDEDALVYLMLANDLLHELYPNAITIAEDVSGMPGLCRPVSEGGIGFDYRLA 257

Branching enzymes (BEs) catalyze the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage yielding a non-reducing end oligosaccharide chain, and subsequent attachment to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. This group includes bacterial and eukaryotic proteins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 406
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|178782 PLN03244, PLN03244, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|200461 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme) Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|188150 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>gnl|CDD|139075 PRK12568, PRK12568, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237794 PRK14705, PRK14705, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|200464 cd11325, AmyAc_GTHase, Alpha amylase catalytic domain found in Glycosyltrehalose trehalohydrolase (also called Maltooligosyl trehalose Trehalohydrolase) Back     alignment and domain information
>gnl|CDD|237795 PRK14706, PRK14706, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|233850 TIGR02402, trehalose_TreZ, malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>gnl|CDD|200488 cd11350, AmyAc_4, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|224440 COG1523, PulA, Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200465 cd11326, AmyAc_Glg_debranch, Alpha amylase catalytic domain found in glycogen debranching enzymes Back     alignment and domain information
>gnl|CDD|200458 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic domain found in eukaryotic Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|233728 TIGR02102, pullulan_Gpos, pullulanase, extracellular, Gram-positive Back     alignment and domain information
>gnl|CDD|233730 TIGR02104, pulA_typeI, pullulanase, type I Back     alignment and domain information
>gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family Back     alignment and domain information
>gnl|CDD|200489 cd11352, AmyAc_5, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain Back     alignment and domain information
>gnl|CDD|131155 TIGR02100, glgX_debranch, glycogen debranching enzyme GlgX Back     alignment and domain information
>gnl|CDD|236543 PRK09505, malS, alpha-amylase; Reviewed Back     alignment and domain information
>gnl|CDD|200454 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|235152 PRK03705, PRK03705, glycogen debranching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200480 cd11341, AmyAc_Pullulanase_LD-like, Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200453 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase catalytic domain found in archaeal, bacterial, and plant Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200491 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|233729 TIGR02103, pullul_strch, alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 237
PLN02447 758 1,4-alpha-glucan-branching enzyme 100.0
PLN02960 897 alpha-amylase 100.0
PRK14705 1224 glycogen branching enzyme; Provisional 100.0
PRK12313 633 glycogen branching enzyme; Provisional 100.0
PRK12568 730 glycogen branching enzyme; Provisional 100.0
PRK14706 639 glycogen branching enzyme; Provisional 100.0
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 100.0
PRK05402 726 glycogen branching enzyme; Provisional 100.0
PRK10785 598 maltodextrin glucosidase; Provisional 100.0
PLN03244 872 alpha-amylase; Provisional 100.0
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 100.0
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 100.0
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 100.0
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 100.0
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 100.0
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 100.0
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 100.0
PRK09505 683 malS alpha-amylase; Reviewed 100.0
KOG0470|consensus 757 100.0
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 100.0
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 100.0
PRK03705 658 glycogen debranching enzyme; Provisional 100.0
PLN00196 428 alpha-amylase; Provisional 100.0
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 100.0
PLN02361 401 alpha-amylase 100.0
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 100.0
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 100.0
PRK13840 495 sucrose phosphorylase; Provisional 99.98
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 99.97
PLN02784 894 alpha-amylase 99.97
TIGR03852 470 sucrose_gtfA sucrose phosphorylase. In the forward 99.97
PLN02877 970 alpha-amylase/limit dextrinase 99.97
COG0366 505 AmyA Glycosidases [Carbohydrate transport and meta 99.96
KOG0471|consensus 545 99.94
TIGR02455 688 TreS_stutzeri trehalose synthase, Pseudomonas stut 99.93
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.93
smart00642166 Aamy Alpha-amylase domain. 99.87
PRK14511 879 maltooligosyl trehalose synthase; Provisional 99.82
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 99.81
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 99.69
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 99.6
KOG2212|consensus 504 99.55
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 99.26
PF14872 811 GHL5: Hypothetical glycoside hydrolase 5 99.17
COG1649 418 Uncharacterized protein conserved in bacteria [Fun 99.05
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 98.93
PF02065 394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 98.81
PF14701 423 hDGE_amylase: glucanotransferase domain of human g 98.79
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 98.42
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 98.41
PF13200316 DUF4015: Putative glycosyl hydrolase domain 98.09
cd06597340 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide 98.02
KOG3625|consensus 1521 98.02
PF02324809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 97.95
cd06602339 GH31_MGAM_SI_GAA This family includes the followin 97.83
cd06600317 GH31_MGAM-like This family includes the following 97.8
cd06594317 GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl 97.77
cd06591319 GH31_xylosidase_XylS XylS is a glycosyl hydrolase 97.72
cd06599317 GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 97.64
cd06604339 GH31_glucosidase_II_MalA Alpha-glucosidase II (alp 97.62
PRK10658 665 putative alpha-glucosidase; Provisional 97.61
PF13199 559 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 97.6
cd06598317 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide 97.59
PRK10426 635 alpha-glucosidase; Provisional 97.56
PF01055 441 Glyco_hydro_31: Glycosyl hydrolases family 31 ; In 97.53
cd06601 332 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) 97.3
PRK14582 671 pgaB outer membrane N-deacetylase; Provisional 97.28
cd06595292 GH31_xylosidase_XylS-like This family represents a 97.2
cd06603339 GH31_GANC_GANAB_alpha This family includes the clo 97.19
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 97.09
cd02875 358 GH18_chitobiase Chitobiase (also known as di-N-ace 96.92
PRK14508 497 4-alpha-glucanotransferase; Provisional 96.89
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 96.86
PLN02635 538 disproportionating enzyme 96.82
KOG1065|consensus 805 96.8
COG1501 772 Alpha-glucosidases, family 31 of glycosyl hydrolas 96.7
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 96.51
PLN02763 978 hydrolase, hydrolyzing O-glycosyl compounds 96.49
cd06589265 GH31 The enzymes of glycosyl hydrolase family 31 ( 96.43
PF07745 332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 96.2
PRK11052 695 malQ 4-alpha-glucanotransferase; Provisional 96.14
TIGR00217 513 malQ 4-alpha-glucanotransferase. This enzyme is kn 96.08
PF02446 496 Glyco_hydro_77: 4-alpha-glucanotransferase; InterP 95.82
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 95.77
cd06562348 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c 95.62
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 95.53
PF02324 809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 95.32
cd02742303 GH20_hexosaminidase Beta-N-acetylhexosaminidases o 95.18
COG3867 403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 95.03
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 94.86
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 94.71
cd06564326 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( 94.7
PF14488166 DUF4434: Domain of unknown function (DUF4434) 94.39
cd06568329 GH20_SpHex_like A subgroup of the Glycosyl hydrola 94.29
PF05913 357 DUF871: Bacterial protein of unknown function (DUF 94.28
smart00812 384 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro 93.97
cd06547 339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 93.88
COG2342300 Predicted extracellular endo alpha-1,4 polygalacto 93.88
cd06570311 GH20_chitobiase-like_1 A functionally uncharacteri 93.87
cd02874 313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 93.87
cd06563357 GH20_chitobiase-like The chitobiase of Serratia ma 93.86
COG3589 360 Uncharacterized conserved protein [Function unknow 93.83
PF01120346 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 93.57
cd06569 445 GH20_Sm-chitobiase-like The chitobiase of Serratia 93.42
cd06565301 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) 93.19
PLN02950 909 4-alpha-glucanotransferase 93.01
PRK10605362 N-ethylmaleimide reductase; Provisional 92.87
COG1640 520 MalQ 4-alpha-glucanotransferase [Carbohydrate tran 92.52
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 92.5
PF14883294 GHL13: Hypothetical glycosyl hydrolase family 13 92.36
PLN03236 745 4-alpha-glucanotransferase; Provisional 91.86
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 91.53
PF02449 374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 91.36
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 91.22
PF00728351 Glyco_hydro_20: Glycosyl hydrolase family 20, cata 91.13
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 90.98
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 90.65
cd02929 370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 90.32
cd02931 382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 90.27
PRK15452 443 putative protease; Provisional 90.24
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 90.01
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 89.85
TIGR03356 427 BGL beta-galactosidase. 89.34
PLN02411 391 12-oxophytodienoate reductase 89.3
PF10566273 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: 89.16
PRK13523337 NADPH dehydrogenase NamA; Provisional 89.1
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 88.9
COG3345 687 GalA Alpha-galactosidase [Carbohydrate transport a 88.57
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 88.54
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 88.03
cd06546256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 87.99
cd02877280 GH18_hevamine_XipI_class_III This conserved domain 87.48
KOG2499|consensus 542 87.29
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 87.29
PF03644 311 Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int 86.81
PLN02460338 indole-3-glycerol-phosphate synthase 83.39
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 82.77
cd02876 318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 82.57
PRK09852 474 cryptic 6-phospho-beta-glucosidase; Provisional 82.2
smart00636 334 Glyco_18 Glycosyl hydrolase family 18. 81.63
PLN03231357 putative alpha-galactosidase; Provisional 81.16
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 80.75
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 80.75
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information 
Probab=100.00  E-value=2.1e-47  Score=360.91  Aligned_cols=225  Identities=58%  Similarity=0.969  Sum_probs=207.3

Q ss_pred             CCcCChH-HhhHHHHHcCccc----cCccCC--CCCCCCccccccc-CCCCCHHHHHHHHHHHHHcCCEEEEEeeccccC
Q psy9004           3 TNGFGTP-EQLKYLVDECHKA----GLFGTP--EQLKYLVDECHKA-GLFGTPEQLKYLVDECHKAGLYVLLDVVHSHAS   74 (237)
Q Consensus         3 ~~~~Gl~-~~L~yl~~lGv~~----pi~~~~--~~~gY~~~d~~~v-~~~Gt~~~l~~lv~~~H~~Gi~VilD~v~nh~~   74 (237)
                      +++.+++ ++|+||++||+++    ||+..+  .+|||++.+|+++ ++|||+++||+||++||++||+||||+|+||++
T Consensus       247 gty~~~~~~~L~ylk~LG~t~I~LmPi~e~~~~~~wGY~~~~~fa~~~~~Gtp~dlk~LVd~aH~~GI~VilDvV~nH~~  326 (758)
T PLN02447        247 NSYREFADDVLPRIKALGYNAVQLMAIQEHAYYGSFGYHVTNFFAVSSRSGTPEDLKYLIDKAHSLGLRVLMDVVHSHAS  326 (758)
T ss_pred             CCHHHHHHHHHHHHHHcCCCEEEECCccccCCCCCCCcCcccCcccccccCCHHHHHHHHHHHHHCCCEEEEEecccccc
Confidence            4566765 4699999999987    888766  5899999999999 999999999999999999999999999999999


Q ss_pred             CCccccccCCCCCCCCccCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCcEEEecccCccccccCCCCCCC
Q psy9004          75 KNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGF  154 (237)
Q Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ln~~~p~v~~~i~~~~~~w~~~~giDGfR~D~~~~l~~~~~~~~~~~  154 (237)
                      .+....+..++++...||+..+.+..+.|++..+|+.+++|+++|++++++|+++|+|||||||++++|+|.++++..++
T Consensus       327 ~~~~~gl~~fDg~~~~Yf~~~~~g~~~~w~~~~~N~~~~eVr~fLl~~~~~Wl~ey~IDGfRfDaV~smlY~~hg~~~~f  406 (758)
T PLN02447        327 KNTLDGLNGFDGTDGSYFHSGPRGYHWLWDSRLFNYGNWEVLRFLLSNLRWWLEEYKFDGFRFDGVTSMLYHHHGLQMAF  406 (758)
T ss_pred             ccccccccccCCCCccccccCCCCCcCcCCCceecCCCHHHHHHHHHHHHHHHHHhCcccccccchhhhhccccCccccc
Confidence            87666667788877788887666677789988999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccCccCChhHHHHHHHHHHHHHhhCCCeEEEEecCCCCCCcccccccCCccccccccCCcccccccc
Q psy9004         155 SGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYG  227 (237)
Q Consensus       155 ~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~i~E~~~~~~~~~~~~~~~~~gfd~~~~~~~~~~~~~~  227 (237)
                      ++++.+.+|..++.++..||++++..+++.+|++++|||+.++.+.+|++..++|+||||.|+|++++.|.+.
T Consensus       407 ~~~~~~~~g~~~d~~a~~fL~~~N~~i~~~~p~~~~IAEd~s~~p~l~~p~~~GGlGFDykw~Mg~~~~~l~~  479 (758)
T PLN02447        407 TGNYNEYFGMATDVDAVVYLMLANDLLHGLYPEAVTIAEDVSGMPTLCRPVQEGGVGFDYRLAMAIPDKWIEL  479 (758)
T ss_pred             ccCcccccCCccChHHHHHHHHHHHHHHHhCCCeEEEEEcCCCCCCccccCCCCcCCcceEECCccchHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999997654

>PLN02960 alpha-amylase Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>KOG2212|consensus Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ Back     alignment and domain information
>KOG3625|consensus Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase Back     alignment and domain information
>cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II Back     alignment and domain information
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride Back     alignment and domain information
>cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate Back     alignment and domain information
>cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 Back     alignment and domain information
>cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities Back     alignment and domain information
>PRK10658 putative alpha-glucosidase; Provisional Back     alignment and domain information
>PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A Back     alignment and domain information
>cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY Back     alignment and domain information
>PRK10426 alpha-glucosidase; Provisional Back     alignment and domain information
>PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end Back     alignment and domain information
>PRK14582 pgaB outer membrane N-deacetylase; Provisional Back     alignment and domain information
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus Back     alignment and domain information
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>PRK14508 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02635 disproportionating enzyme Back     alignment and domain information
>KOG1065|consensus Back     alignment and domain information
>COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>PLN02763 hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK11052 malQ 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>TIGR00217 malQ 4-alpha-glucanotransferase Back     alignment and domain information
>PF02446 Glyco_hydro_77: 4-alpha-glucanotransferase; InterPro: IPR003385 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>smart00812 Alpha_L_fucos Alpha-L-fucosidase Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>COG2342 Predicted extracellular endo alpha-1,4 polygalactosaminidase or related polysaccharide hydrolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06569 GH20_Sm-chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>COG1640 MalQ 4-alpha-glucanotransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 Back     alignment and domain information
>PLN03236 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PF00728 Glyco_hydro_20: Glycosyl hydrolase family 20, catalytic domain; InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3 Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>COG3345 GalA Alpha-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information
>KOG2499|consensus Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>PLN03231 putative alpha-galactosidase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
3amk_A 702 Structure Of The Starch Branching Enzyme I (Bei) Fr 2e-64
3aml_A 755 Structure Of The Starch Branching Enzyme I (Bei) Fr 3e-64
3k1d_A 722 Crystal Structure Of Glycogen Branching Enzyme Syno 5e-23
1m7x_A 617 The X-Ray Crystallographic Structure Of Branching E 9e-22
1eh9_A 558 Crystal Structure Of Sulfolobus Solfataricus Glycos 9e-09
3vgg_A 558 Crystal Structure Of Glycosyltrehalose Trehalohydro 9e-09
1eha_A 558 Crystal Structure Of Glycosyltrehalose Trehalohydro 1e-08
3vgd_A 558 Ctystal Structure Of Glycosyltrehalose Trehalohydro 3e-08
3vge_A 558 Crystal Structure Of Glycosyltrehalose Trehalohydro 5e-08
2bhu_A 602 Crystal Structure Of Deinococcus Radiodurans Maltoo 3e-07
1j0j_A 588 Crystal Structure Of Neopullulanase E357q Complex W 7e-07
1j0h_A 588 Crystal Structure Of Bacillus Stearothermophilus Ne 7e-07
4gkl_A 422 Crystal Structure Of A Noncanonic Maltogenic Alpha- 8e-07
2bhy_A 602 Crystal Structure Of Deinococcus Radiodurans Maltoo 9e-07
3faw_A 877 Crystal Structure Of The Group B Streptococcus Pull 7e-06
2vnc_A 718 Crystal Structure Of Glycogen Debranching Enzyme Tr 1e-05
1gvi_A 588 Thermus Maltogenic Amylase In Complex With Beta-Cd 2e-05
1sma_A 588 Crystal Structure Of A Maltogenic Amylase Length = 2e-05
2ya0_A 714 Catalytic Module Of The Multi-Modular Glycogen-Degr 3e-05
2ya1_A 1014 Product Complex Of A Multi-Modular Glycogen-Degradi 3e-05
2ya2_A 708 Catalytic Module Of The Multi-Modular Glycogen-Degr 5e-05
3m07_A 618 1.4 Angstrom Resolution Crystal Structure Of Putati 7e-05
2wsk_A 657 Crystal Structure Of Glycogen Debranching Enzyme Gl 6e-04
2e8y_A 718 Crystal Structure Of Pullulanase Type I From Bacill 7e-04
>pdb|3AMK|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 702 Back     alignment and structure 
Iteration: 1

 Score =  241 bits (615), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/182 (62%), Positives = 137/182 (75%), Gaps = 3/182 (1%)
Query: 45  GTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFD---GTQACFFHDGPRGTHP 101
           GTPE LKYLVD+ H  GL VL+DVVHSHAS NV DGLN +D    T   +FH G RG H 
Sbjct: 248 GTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQNTHESYFHTGDRGYHK 307
Query: 102 LWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEY 161
           LWDSRLFNY+  EVLRFLLSNLR++++E+ FDGFRFDGVTSMLYH+HG  +GF+G+Y EY
Sbjct: 308 LWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHGINKGFTGNYKEY 367
Query: 162 FGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGL 221
           F L+ D DA++Y+M+AN  +H   PE   +AEDVSGMP  CRPV EGG GFD+RL     
Sbjct: 368 FSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGGVGFDFRLAMAIP 427
Query: 222 DK 223
           D+
Sbjct: 428 DR 429
>pdb|3AML|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 755 Back     alignment and structure
>pdb|3K1D|A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H37rv Length = 722 Back     alignment and structure
>pdb|1M7X|A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme Length = 617 Back     alignment and structure
>pdb|1EH9|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Glycosyltrehalose Trehalohydrolase Length = 558 Back     alignment and structure
>pdb|3VGG|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase (E283q) Complexed With Maltoheptaose Length = 558 Back     alignment and structure
>pdb|1EHA|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase From Sulfolobus Solfataricus Length = 558 Back     alignment and structure
>pdb|3VGD|A Chain A, Ctystal Structure Of Glycosyltrehalose Trehalohydrolase (D252e) Length = 558 Back     alignment and structure
>pdb|3VGE|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase (D252s) Length = 558 Back     alignment and structure
>pdb|2BHU|A Chain A, Crystal Structure Of Deinococcus Radiodurans Maltooligosyltrehalose Trehalohydrolase Length = 602 Back     alignment and structure
>pdb|1J0J|A Chain A, Crystal Structure Of Neopullulanase E357q Complex With Maltotetraose Length = 588 Back     alignment and structure
>pdb|1J0H|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Neopullulanase Length = 588 Back     alignment and structure
>pdb|4GKL|A Chain A, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase Amyb From Thermotoga Neapolitana Length = 422 Back     alignment and structure
>pdb|2BHY|A Chain A, Crystal Structure Of Deinococcus Radiodurans Maltooligosyltrehalose Trehalohydrolase In Complex With Trehalose Length = 602 Back     alignment and structure
>pdb|3FAW|A Chain A, Crystal Structure Of The Group B Streptococcus Pullulanase Sap Length = 877 Back     alignment and structure
>pdb|2VNC|A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus Length = 718 Back     alignment and structure
>pdb|1GVI|A Chain A, Thermus Maltogenic Amylase In Complex With Beta-Cd Length = 588 Back     alignment and structure
>pdb|1SMA|A Chain A, Crystal Structure Of A Maltogenic Amylase Length = 588 Back     alignment and structure
>pdb|2YA0|A Chain A, Catalytic Module Of The Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua Length = 714 Back     alignment and structure
>pdb|2YA1|A Chain A, Product Complex Of A Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua Length = 1014 Back     alignment and structure
>pdb|2YA2|A Chain A, Catalytic Module Of The Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua In Complex With An Inhibitor Length = 708 Back     alignment and structure
>pdb|3M07|A Chain A, 1.4 Angstrom Resolution Crystal Structure Of Putative Alpha Amylase From Salmonella Typhimurium Length = 618 Back     alignment and structure
>pdb|2WSK|A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Glgx From Escherichia Coli K-12 Length = 657 Back     alignment and structure
>pdb|2E8Y|A Chain A, Crystal Structure Of Pullulanase Type I From Bacillus Subtilis Str. 168 Length = 718 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 1e-102
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 6e-42
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 1e-41
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 3e-26
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 3e-25
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 6e-23
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 5e-13
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 6e-13
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 2e-12
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 2e-12
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 3e-12
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 3e-12
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 7e-12
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 1e-11
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 4e-11
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 8e-11
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 1e-10
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 2e-10
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 2e-10
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 3e-10
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 4e-10
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 1e-09
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 1e-09
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 7e-09
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 2e-08
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 3e-08
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 4e-08
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 5e-08
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 5e-08
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 8e-08
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 9e-08
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 9e-08
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 1e-07
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 4e-07
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 7e-07
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 4e-06
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 6e-06
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 7e-06
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 7e-06
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 8e-04
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 2e-05
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 3e-05
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 8e-04
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 3e-05
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 5e-05
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 1e-04
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 8e-04
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
 Score =  311 bits (798), Expect = e-102
 Identities = 113/177 (63%), Positives = 135/177 (76%), Gaps = 3/177 (1%)

Query: 44  FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFD---GTQACFFHDGPRGTH 100
            GTPE LKYLVD+ H  GL VL+DVVHSHAS NV DGLN +D    T   +FH G RG H
Sbjct: 247 SGTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQNTHESYFHTGDRGYH 306

Query: 101 PLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDE 160
            LWDSRLFNY+  EVLRFLLSNLR++++E+ FDGFRFDGVTSMLYH+HG  +GF+G+Y E
Sbjct: 307 KLWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHGINKGFTGNYKE 366

Query: 161 YFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLG 217
           YF L+ D DA++Y+M+AN  +H   PE   +AEDVSGMP  CRPV EGG GFD+RL 
Sbjct: 367 YFSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGGVGFDFRLA 423
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Length = 602 Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Length = 618 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Length = 558 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 750 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Length = 657 Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Length = 877 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Length = 718 Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Length = 1014 Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Length = 921 Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Length = 718 Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Length = 714 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Length = 884 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Length = 1083 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Length = 448 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Length = 471 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 100.0
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 100.0
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 100.0
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 100.0
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 100.0
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 100.0
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 100.0
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 100.0
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 100.0
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 100.0
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 100.0
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 100.0
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 100.0
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 100.0
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 100.0
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 100.0
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 100.0
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 100.0
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 100.0
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 100.0
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 100.0
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 100.0
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 100.0
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 100.0
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 100.0
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 100.0
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 100.0
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 100.0
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 100.0
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 100.0
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 100.0
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 100.0
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 100.0
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 100.0
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 100.0
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 100.0
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 100.0
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 100.0
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 100.0
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 100.0
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 100.0
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 100.0
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 100.0
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 100.0
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 100.0
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 100.0
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 100.0
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 100.0
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 100.0
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 100.0
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 100.0
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 100.0
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 100.0
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 100.0
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 100.0
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 100.0
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 100.0
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 100.0
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 99.98
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 99.97
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.96
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 99.95
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 99.95
3klk_A 1039 Glucansucrase; native form, open conformation, mul 99.73
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.69
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.68
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.46
3klk_A 1039 Glucansucrase; native form, open conformation, mul 99.13
3mi6_A 745 Alpha-galactosidase; NESG, structural genomics, PS 99.07
2yfo_A 720 Alpha-galactosidase-sucrose kinase agask; hydrolas 98.99
2xn2_A 732 Alpha-galactosidase; hydrolase, glycosidase; HET: 98.78
4fnq_A 729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 98.62
1zy9_A 564 Alpha-galactosidase; TM1192, struc genomics, joint 98.25
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 98.06
2f2h_A 773 Putative family 31 glucosidase YICI; BETA8alpha8 b 97.6
2g3m_A 693 Maltase, alpha-glucosidase; hydrolase, glycoside h 97.49
3lpp_A 898 Sucrase-isomaltase; glycoside hydrolase family 31, 97.42
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 97.36
4ba0_A 817 Alpha-glucosidase, putative, ADG31B; hydrolase; HE 97.16
3vmn_A 643 Dextranase; TIM barrel, immunoglobrin fold, greek- 97.13
3l4y_A 875 Maltase-glucoamylase, intestinal; glycoside hydrol 97.07
3cc1_A 433 BH1870 protein, putative alpha-N-acetylgalactosami 97.02
3nsx_A 666 Alpha-glucosidase; structural genomics, PSI-2, pro 97.02
1hjs_A 332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 96.67
1ur4_A 399 Galactanase; hydrolase, beta-1, glycoside hydrolas 96.63
2xvl_A 1020 Alpha-xylosidase, putative, XYL31A; hydrolase, gly 96.49
2aam_A309 Hypothetical protein TM1410; structural genomics, 96.33
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 96.27
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 96.09
3n12_A 333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 96.08
1x1n_A 524 4-alpha-glucanotransferase; disproportionating enz 96.01
1esw_A 500 Amylomaltase; (beta,alpha)8-barrel, glucanotransfe 96.0
1vjz_A 341 Endoglucanase; TM1752, structural genomics, JCSG, 95.99
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 95.79
1uas_A362 Alpha-galactosidase; TIM-barrel, beta-alpha-barrel 95.77
4axn_A 328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 95.76
3pzg_A 383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 95.58
1tz7_A 505 4-alpha-glucanotransferase; (beta, alpha)8- barrel 95.58
1h4p_A 408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 95.55
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 95.51
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 95.46
1x7f_A 385 Outer surface protein; structural genomics, unknow 95.46
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 95.26
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 95.06
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 95.01
2p0o_A 372 Hypothetical protein DUF871; structural genomics, 94.81
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 94.78
2x2h_A 1027 Alpha-1,4-glucan lyase isozyme 1; anhydrofructose 94.7
3qho_A 458 Endoglucanase, 458AA long hypothetical endo-1,4-be 94.64
3top_A 908 Maltase-glucoamylase, intestinal; membrane, hydrol 94.62
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 94.49
3a5v_A 397 Alpha-galactosidase; beta/alpha barrel, N-glycosyl 94.48
3ian_A 321 Chitinase; structural genomics, hydrolase, glycosi 94.25
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 94.1
2ki0_A36 DS119; beta-alpha-beta, de novo protein; NMR {Synt 93.6
1rh9_A 373 Endo-beta-mannanase; endo-beta-mannase, retaining, 93.55
3cz8_A 319 Putative sporulation-specific glycosylase YDHD; st 93.51
3fnd_A 312 Chitinase; TIM-barrel, structural genomics, PSI-2, 93.34
2zxd_A 455 Alpha-L-fucosidase, putative; TIM barrel, hydrolas 93.3
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 92.96
4awe_A 387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 92.92
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 92.88
1szn_A 417 Alpha-galactosidase; (beta/alpha)8 barrel,TWO doma 92.8
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 92.55
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 92.53
3eyp_A 469 Putative alpha-L-fucosidase; structural genomics, 92.51
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 92.1
3a21_A 614 Putative secreted alpha-galactosidase; beta-alpha- 92.02
2uy2_A294 Endochitinase; carbohydrate metabolism, polysaccha 91.89
1jak_A512 Beta-N-acetylhexosaminidase; glycoside hydrolase, 91.81
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 91.75
2wvv_A 450 Alpha-L-fucosidase; alpha-L-fucose, hydrolase, gly 91.75
2xtk_A310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 91.74
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 91.6
1cnv_A299 Concanavalin B; plant chitinase, chitin binding pr 91.33
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 91.18
4f9d_A618 Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; 90.98
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 90.69
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 90.66
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 90.62
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 90.61
3ues_A 478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 90.4
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 90.37
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 90.31
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 90.31
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 90.14
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 89.83
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 89.73
4do4_A 400 Alpha-N-acetylgalactosaminidase; pharmacological c 89.67
3a24_A 641 Alpha-galactosidase; glycoside hydrolase family 97 89.41
2osx_A 481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 89.15
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 89.13
1uuq_A 440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 89.1
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 89.04
3ozo_A 572 N-acetylglucosaminidase; beta-N-acetyl-D-hexosamin 88.99
3gyc_A 393 Putative glycoside hydrolase; YP_001304622.1, stru 88.87
1now_A 507 Beta-hexosaminidase beta chain; (beta/alpha)8-barr 88.6
2gjx_A 507 Beta-hexosaminidase alpha chain; beta-hexosaminida 88.58
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 88.49
2hvm_A273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 87.96
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 87.94
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 87.32
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 87.27
3hg3_A 404 Alpha-galactosidase A; glycoprotein, carbohydrate- 86.79
3gh5_A525 HEX1, beta-hexosaminidase; beta-N-acetylhexosamini 86.18
3d3a_A 612 Beta-galactosidase; protein structure initiative I 86.18
3mu7_A273 XAIP-II, xylanase and alpha-amylase inhibitor prot 85.52
2d73_A 738 Alpha-glucosidase SUSB; glycoside hydrolase family 85.33
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 84.45
1xyz_A 347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 83.73
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 83.6
3rcn_A 543 Beta-N-acetylhexosaminidase; structural genomics, 83.2
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 82.84
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 82.84
3cui_A 315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 82.75
3gza_A 443 Putative alpha-L-fucosidase; NP_812709.1, structur 82.36
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 82.23
3lrk_A 479 Alpha-galactosidase 1; tetramer, GH27, glycoprotei 82.09
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 82.04
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 80.77
4gbu_A 400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 80.7
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 80.28
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
Probab=100.00  E-value=4.9e-46  Score=356.80  Aligned_cols=226  Identities=52%  Similarity=0.905  Sum_probs=200.9

Q ss_pred             CCCcCChHH-hhHHHHHcCccc----cCccCC--CCCCCCccccccc-CCCCCHHHHHHHHHHHHHcCCEEEEEeecccc
Q psy9004           2 RTNGFGTPE-QLKYLVDECHKA----GLFGTP--EQLKYLVDECHKA-GLFGTPEQLKYLVDECHKAGLYVLLDVVHSHA   73 (237)
Q Consensus         2 ~~~~~Gl~~-~L~yl~~lGv~~----pi~~~~--~~~gY~~~d~~~v-~~~Gt~~~l~~lv~~~H~~Gi~VilD~v~nh~   73 (237)
                      .|+++||++ +|+||++|||++    ||+..+  .+|||++.||+++ |+|||+++|++||++||++||+||||+|+||+
T Consensus       197 ~Gt~~~l~~~~L~yLk~LGvt~I~L~Pi~e~~~~~~~GY~~~dy~a~~~~~Gt~~df~~lv~~~H~~Gi~VilD~V~NH~  276 (755)
T 3aml_A          197 VSTYREFADNVLPRIRANNYNTVQLMAIMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHA  276 (755)
T ss_dssp             CCCHHHHHHHTHHHHHHTTCCEEEEESCEECSCGGGTTCSCSEEEEECGGGCCHHHHHHHHHHHHHTTCEEEEEECCSCB
T ss_pred             CCCHHHHHHHHHHHHHHcCCCEEEECchhcCCCCCCCCCccCCCCccCCCCCCHHHHHHHHHHHHHCCCEEEEEEecccc
Confidence            478999988 799999999987    898887  7899999999999 99999999999999999999999999999999


Q ss_pred             CCCccccccCCC---CCCCCccCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCcEEEecccCccccccCCC
Q psy9004          74 SKNVLDGLNEFD---GTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGC  150 (237)
Q Consensus        74 ~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~ln~~~p~v~~~i~~~~~~w~~~~giDGfR~D~~~~l~~~~~~~  150 (237)
                      +.++..++..++   +..+.||+..+.+....|+..+||+.||+|+++|++++++|++++||||||||++++|.++++++
T Consensus       277 ~~~~~~g~~~fd~~~~~~~~yf~~~~~g~~~~w~~~~lN~~~p~V~~~l~~~l~~Wl~e~gvDGfR~Dav~~m~~~~~g~  356 (755)
T 3aml_A          277 SNNVTDGLNGYDVGQNTHESYFHTGDRGYHKLWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHGI  356 (755)
T ss_dssp             CCCTTTSGGGGCSSCCGGGSSBCCGGGGEETTTTEECBCTTSHHHHHHHHHHHHHHHHHHCCCEEEETTHHHHHBTTTTT
T ss_pred             ccccccchhccccCCCCCcceeecCCCCccCCCCCceeccCCHHHHHHHHHHHHHHHHHcCCCEEEecchhhhhhcccCc
Confidence            998766655555   44567777655566678999999999999999999999999999999999999999998887777


Q ss_pred             CCCCCCCcccccCccCChhHHHHHHHHHHHHHhhCCCeEEEEecCCCCCCcccccccCCccccccccCCcccccccc
Q psy9004         151 GEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGRPGLDKSFYG  227 (237)
Q Consensus       151 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~i~E~~~~~~~~~~~~~~~~~gfd~~~~~~~~~~~~~~  227 (237)
                      +.++.+.+.+.++.+++.++..||+++++.+++.+|++++|||.+++.+..++++..+++||||.++|+|+..|.++
T Consensus       357 ~~~f~~~~~~~~~~~~~~~ai~fl~~~~~~v~~~~p~~~lIaE~~~~~p~~~~~~~~gglgFd~~~~~~~~~~~~~~  433 (755)
T 3aml_A          357 NKGFTGNYKEYFSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGGVGFDFRLAMAIPDRWIDY  433 (755)
T ss_dssp             TCCCCSCGGGTSSTTBCHHHHHHHHHHHHHHHHHCTTCEEEECCSSCCTTTTSCGGGTSCCCSEEECTTHHHHHHHH
T ss_pred             ccccccccccccccccchhHHHHHHHHHHHHHHHCCCeEEEEEccCCCccceeeccCCCccccccccccchHHHHHH
Confidence            76777777777777788888999999999999999999999999999999888888889999999999988776654
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Back     alignment and structure
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* Back     alignment and structure
>3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* Back     alignment and structure
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Back     alignment and structure
>3cc1_A BH1870 protein, putative alpha-N-acetylgalactosaminidase; structural genomic center for structural genomics, JCSG; HET: MSE PGE PG4 P33; 2.00A {Bacillus halodurans c-125} Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Back     alignment and structure
>2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>1x1n_A 4-alpha-glucanotransferase; disproportionating enzyme, amylomaltase, D-enzyme; 1.80A {Solanum tuberosum} SCOP: c.1.8.1 Back     alignment and structure
>1esw_A Amylomaltase; (beta,alpha)8-barrel, glucanotransferase, alpha-amylase FAMI acarbose, transferase; HET: ACR; 1.90A {Thermus aquaticus} SCOP: c.1.8.1 PDB: 1cwy_A* 1fp8_A 1fp9_A 2owc_A* 2oww_A* 2owx_A* 2x1i_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1uas_A Alpha-galactosidase; TIM-barrel, beta-alpha-barrel, greek KEY motif, hydrolase; HET: GLA; 1.50A {Oryza sativa} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1tz7_A 4-alpha-glucanotransferase; (beta, alpha)8- barrel; 2.15A {Aquifex aeolicus} SCOP: c.1.8.1 Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>3a5v_A Alpha-galactosidase; beta/alpha barrel, N-glycosylation, hydrolase; HET: MAN NAG BMA 1PG; 2.00A {Umbelopsis vinacea} Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>2ki0_A DS119; beta-alpha-beta, de novo protein; NMR {Synthetic} Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>2zxd_A Alpha-L-fucosidase, putative; TIM barrel, hydrolase; HET: ZXD; 2.15A {Thermotoga maritima} PDB: 2zwy_A* 2zx5_A* 2zx6_A* 2zx7_A* 2zwz_A* 2zx9_A* 2zxa_A* 2zxb_A* 2zx8_A* 1hl9_A* 1hl8_A* 1odu_A* 2wsp_A* Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>1szn_A Alpha-galactosidase; (beta/alpha)8 barrel,TWO domains, glycoprotein, hydrolase; HET: NAG BMA MAN; 1.54A {Hypocrea jecorina} SCOP: b.71.1.1 c.1.8.1 PDB: 1t0o_A* Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>2wvv_A Alpha-L-fucosidase; alpha-L-fucose, hydrolase, glycoside hydrolase family 29; 1.73A {Bacteroides thetaiotaomicron} PDB: 2xii_A* 2xib_A* 2wvv_B 2wvt_A* 2wvu_A* 2wvs_A* Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>4f9d_A Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; family 4 carbohydrate esterase, TIM barrel, hydrolase, deace carbohydrate/sugar binding; HET: MES; 1.90A {Escherichia coli} PDB: 4f9j_A* Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>4do4_A Alpha-N-acetylgalactosaminidase; pharmacological chaperone, (beta/alpha)8 barrel, glycosidase carbohydrate-binding protein, glycoprotein, lysosome; HET: NAG BMA MAN DJN CIT FUC; 1.40A {Homo sapiens} PDB: 3h54_A* 3h53_A* 3igu_A* 3h55_A* 4do5_A* 4do6_A* 1ktb_A* 1ktc_A* Back     alignment and structure
>3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>3ozo_A N-acetylglucosaminidase; beta-N-acetyl-D-hexosaminidase, hydrolase-hydrolase inhibito; HET: NGT; 2.00A {Ostrinia furnacalis} PDB: 3nsn_A* 3nsm_A* 3ozp_A* 3s6t_A* 3vtr_A* Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* Back     alignment and structure
>2gjx_A Beta-hexosaminidase alpha chain; beta-hexosaminidase A, glycosidase, TAY-sachs disease, GM2 ganglisode, TIM barrel, hydrolase; HET: NAG BMA NDG; 2.80A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 2gk1_A* Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>3hg3_A Alpha-galactosidase A; glycoprotein, carbohydrate-binding protein, glycosidase, Lys enzyme, (beta/alpha)8 barrel, disease mutation; HET: NAG BMA MAN GLA GLC 2PE; 1.90A {Homo sapiens} PDB: 3tv8_A* 3lx9_A* 3lxa_A* 3lxb_A* 3lxc_A* 3s5z_A* 1r47_A* 1r46_A* 3gxn_A* 3gxt_A* 3hg2_A* 3hg4_A* 3hg5_A* 3gxp_A* 3s5y_A* Back     alignment and structure
>3gh5_A HEX1, beta-hexosaminidase; beta-N-acetylhexosaminidase, glycosphingolipids, paenibacill GH20, hydrolase, structural genomics, NPPSFA; HET: NAG; 1.60A {Paenibacillus SP} PDB: 3gh4_A* 3gh7_A* 3sur_A* 3sus_A* 3sut_A* 3suu_A* 3suv_A* 3suw_A* Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Back     alignment and structure
>2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>3rcn_A Beta-N-acetylhexosaminidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta half sandwich; HET: MSE; 2.51A {Arthrobacter aurescens} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomic center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>3lrk_A Alpha-galactosidase 1; tetramer, GH27, glycoprotein, glycosida hydrolase; HET: NAG BTB; 1.95A {Saccharomyces cerevisiae} PDB: 3lrl_A* 3lrm_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 237
d1m7xa3 396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 2e-17
d1bf2a3 475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 5e-12
d1eh9a3 400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 1e-08
d1gcya2357 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m 1e-08
d1jaea2378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 4e-08
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 1e-07
d2d3na2 394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 3e-07
d1iv8a2 653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 3e-07
d1iv8a2 653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 2e-05
d1g5aa2 554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 5e-07
d1g94a2354 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa 6e-07
d1m53a2 478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 1e-06
d1mxga2361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 8e-06
d1uoka2 479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 1e-05
d1hvxa2 393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 1e-05
d1ht6a2347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 2e-05
d1e43a2 393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 2e-05
d1ud2a2 390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 4e-05
d1ua7a2344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 6e-05
d1hx0a2 403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 8e-05
d1gjwa2 572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 1e-04
d2bhua3 420 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro 0.003
d1wzla3382 c.1.8.1 (A:121-502) Maltogenic amylase, central do 0.004
d1wzaa2 409 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth 0.004
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: 1,4-alpha-glucan branching enzyme, central domain
species: Escherichia coli [TaxId: 562]

 Score = 78.1 bits (191), Expect = 2e-17
 Identities = 56/173 (32%), Positives = 85/173 (49%), Gaps = 3/173 (1%)

Query: 44  FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLW 103
           FGT +  +Y +D  H AGL V+LD V  H   +    L EFDGT      D   G H  W
Sbjct: 86  FGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDD-FALAEFDGTNLYEHSDPREGYHQDW 144

Query: 104 DSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFG 163
           ++ ++NY   EV  FL+ N  +++E +  D  R D V SM+Y ++             FG
Sbjct: 145 NTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDY--SRKEGEWIPNEFG 202

Query: 164 LNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRL 216
              + +A+ +L   N+ L ++    +T+AE+ +  P   RP   GG GF Y+ 
Sbjct: 203 GRENLEAIEFLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYKW 255
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 100.0
d1h3ga3 422 Cyclomaltodextrinase, central domain {Flavobacteri 100.0
d1ea9c3 382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 100.0
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1qhoa4 407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 100.0
d1m7xa3 396 1,4-alpha-glucan branching enzyme, central domain 100.0
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d1wzaa2 409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 100.0
d2aaaa2 381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 100.0
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1lwha2 391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 100.0
d1ji1a3 432 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 100.0
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 100.0
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 100.0
d1jaea2 378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.98
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.98
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.97
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 99.97
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.97
d1r7aa2 434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.96
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.96
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.94
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 98.28
d2f2ha4338 Putative glucosidase YicI, domain 2 {Escherichia c 97.92
d1ur4a_ 387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 97.44
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 97.19
d1ceoa_ 340 Endoglucanase CelC {Clostridium thermocellum [TaxI 97.12
d1rh9a1 370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 96.88
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 96.87
d2aama1285 Hypothetical protein TM1410 {Thermotoga maritima [ 96.86
d2pb1a1 394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 96.57
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 96.54
d1x1na1 523 Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax 96.54
d1tz7a1 485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 96.38
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 96.26
d1foba_ 334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 96.24
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 96.16
d1eswa_ 500 Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} 96.06
d1h4pa_ 408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 96.06
d1hl9a2350 Putative alpha-L-fucosidase, catalytic domain {The 95.95
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 95.94
d1uuqa_ 410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 95.86
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 95.75
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 95.22
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 94.99
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 94.52
d2gjxa1 362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 94.22
d1r46a2292 Melibiase {Human (Homo sapiens) [TaxId: 9606]} 94.02
d1nowa1 353 beta-hexosaminidase B {Human (Homo sapiens) [TaxId 93.98
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 93.88
d1uasa2273 Melibiase {Rice (Oryza sativa) [TaxId: 4530]} 93.77
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 93.74
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 93.32
d1kwga2 393 A4 beta-galactosidase {Thermus thermophilus [TaxId 93.3
d1qbaa3 443 Bacterial chitobiase (beta-N-acetylhexosaminidase) 92.78
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 92.76
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 92.68
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 92.59
d1szna2314 Melibiase {Trichoderma reesei [TaxId: 51453]} 92.57
d1q45a_ 380 12-oxophytodienoate reductase (OPR, OYE homolog) { 92.45
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 92.25
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 91.84
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 91.6
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 91.53
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 91.47
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 91.31
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 90.4
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 90.33
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 90.14
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 90.07
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 89.93
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 89.04
d1uhva2 346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 87.51
d1yhta1344 Dispersin B, DspB {Actinobacillus actinomycetemcom 86.17
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Neopullulanase, central domain
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=100.00  E-value=2.1e-40  Score=291.99  Aligned_cols=186  Identities=24%  Similarity=0.340  Sum_probs=150.0

Q ss_pred             CCCcCChHHhhHHHHHcCccc----cCccCCCCCCCCccccccc-CCCCCHHHHHHHHHHHHHcCCEEEEEeeccccCCC
Q psy9004           2 RTNGFGTPEQLKYLVDECHKA----GLFGTPEQLKYLVDECHKA-GLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKN   76 (237)
Q Consensus         2 ~~~~~Gl~~~L~yl~~lGv~~----pi~~~~~~~gY~~~d~~~v-~~~Gt~~~l~~lv~~~H~~Gi~VilD~v~nh~~~~   76 (237)
                      +|||+||++|||||++|||++    ||++++++|||+|.||++| |+|||+++|++||++||++||+||+|+|+||++.+
T Consensus        49 ~G~~~gi~~kldyl~~LGv~~i~L~Pi~~~~~~~gy~~~d~~~vd~~~Gt~~~~~~lv~~aH~~Gi~VilD~V~NH~~~~  128 (382)
T d1j0ha3          49 GGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYE  128 (382)
T ss_dssp             CCCHHHHHHTHHHHHHHTCCEEEECCCEECSSSSCCSCSEEEEECTTTCCHHHHHHHHHHHHHTTCEEEEEECCSBCCTT
T ss_pred             CcCHHHHHHhHHHHHHcCCCEEEeCCCCcCCcccCCCcccccccCCCCCCHHHHHHHHHHhhhccceEEEEeeecccccc
Confidence            489999999999999999986    9999999999999999999 99999999999999999999999999999999998


Q ss_pred             ccccccC----CCCCCCCccCCCCC-------CC----CCCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCcEEEecccC
Q psy9004          77 VLDGLNE----FDGTQACFFHDGPR-------GT----HPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVT  141 (237)
Q Consensus        77 ~~~~~~~----~~~~~~~~~~~~~~-------~~----~~~~~~~~ln~~~p~v~~~i~~~~~~w~~~~giDGfR~D~~~  141 (237)
                      +++....    .....+.||.....       ..    ......++||+.||+||++|++++++|++++||||||+|+++
T Consensus       129 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dln~~n~~vr~~l~~~~~~wi~~~giDGfR~Da~~  208 (382)
T d1j0ha3         129 FAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVAN  208 (382)
T ss_dssp             CHHHHHHHHHGGGCTTGGGBCBSSSSCCCSSSCSBCBSTTCTTSBBBCTTSHHHHHHHHHHHHHHHHHHCCCEEEETTGG
T ss_pred             cccchhhhccCCccccCCccccccccccccccccccccccCCCCcccccChHHHHHHHHHHHHhHhhhccccEEEecchh
Confidence            7543211    01112233322110       00    011234689999999999999999999998999999999999


Q ss_pred             ccccccCCCCCCCCCCcccccCccCChhHHHHHHHHHHHHHhhCCCeEEEEecCCCCCCcccccccCCccccccccC
Q psy9004         142 SMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGR  218 (237)
Q Consensus       142 ~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~i~E~~~~~~~~~~~~~~~~~gfd~~~~~  218 (237)
                      ++                          ..++++++..++++..|+++++||.+........     +.+++..++.
T Consensus       209 ~~--------------------------~~~~~~~~~~~~~~~~p~~~~i~e~~~~~~~~~~-----~~~~~~~~~~  254 (382)
T d1j0ha3         209 EI--------------------------DHEFWREFRQEVKALKPDVYILGEIWHDAMPWLR-----GDQFDAVMNY  254 (382)
T ss_dssp             GS--------------------------CHHHHHHHHHHHHHHCTTCEEEECCSSCCGGGCS-----SSSCSEEBCH
T ss_pred             hc--------------------------chhhhhhhhhhhhccCCCccccccccccchhhhc-----cccccccccc
Confidence            98                          3578999999999999999999999977655443     3455555543
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hl9a2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r46a2 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1uasa2 c.1.8.1 (A:1-273) Melibiase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1szna2 c.1.8.1 (A:1-314) Melibiase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} Back     information, alignment and structure