Diaphorina citri psyllid: psy9053


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MSSTLMPYLKVVRHTLNAAMCLENFSSQVVERHNKPEVEVRTSKELLLTPVLISRNEKEKVLIEGSINSVRISIAVKQADEIEKILCHKFMRFMMMRAENFIVLRRKPIEGYDISFLITNFHTEQMYKHKLVDFVLHFMEEIDKEISEMKLAVNARARICSEEFLKRF
ccccccHHHHHHHHHHHHHHHccccccHHHHccccccEEEccccccccccEEEEccccccEEEEccccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHcccCEEECcccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
***TLMPYLKVVRHTLNAAMCLENFSSQVVE*HNKPEVEVRTSKELLLTPVLISRNEKEKVLIEGSINSVRISIAVKQADEIEKILCHKFMRFMMMRAENFIVLRRKPIEGYDISFLITNFHTEQMYKHKLVDFVLHFMEEIDKEISEMKLAVNARARICSEEFLKRF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSTLMPYLKVVRHTLNAAMCLENFSSQVVERHNKPEVEVRTSKELLLTPVLISRNEKEKVLIEGSINSVRISIAVKQADEIEKILCHKFMRFMMMRAENFIVLRRKPIEGYDISFLITNFHTEQMYKHKLVDFVLHFMEEIDKEISEMKLAVNARARICSEEFLKRF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 2/3 complex subunit 4 Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament.very confidentP59998
Actin-related protein 2/3 complex subunit 4 Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament.very confidentP59999
Actin-related protein 2/3 complex subunit 4 Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament.very confidentQ148J6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005885 [CC]Arp2/3 protein complexconfidentGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0003779 [MF]actin bindingconfidentGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0043652 [BP]engulfment of apoptotic cellconfidentGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0006911, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0043277, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0008360 [BP]regulation of cell shapeconfidentGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0030041 [BP]actin filament polymerizationconfidentGO:0022607, GO:0070271, GO:0043933, GO:0030036, GO:0034622, GO:0071840, GO:0071822, GO:0016043, GO:0065003, GO:0044699, GO:0009987, GO:0030029, GO:0007015, GO:0006461, GO:0008154, GO:0044763, GO:0043623, GO:0006996, GO:0051258, GO:0007010, GO:0044085, GO:0008150
GO:0042995 [CC]cell projectionconfidentGO:0005575, GO:0044464, GO:0005623
GO:0010631 [BP]epithelial cell migrationconfidentGO:0040011, GO:0032501, GO:0044707, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0051179, GO:0008150, GO:0001667, GO:0016477, GO:0090132, GO:0044699, GO:0090130
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034314 [BP]Arp2/3 complex-mediated actin nucleationconfidentGO:0033043, GO:0043933, GO:0030036, GO:0051128, GO:0008064, GO:0071840, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0071822, GO:0030838, GO:0051495, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0065008, GO:0051130, GO:0032970, GO:0030029, GO:0009987, GO:0031334, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0006996, GO:0007015, GO:0007010, GO:0045010, GO:0010638, GO:0044087, GO:0008150, GO:0032535, GO:0048522
GO:0000902 [BP]cell morphogenesisconfidentGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0030479 [CC]actin cortical patchconfidentGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0042060 [BP]wound healingconfidentGO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0030674 [MF]protein binding, bridgingconfidentGO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0030670 [CC]phagocytic vesicle membraneconfidentGO:0030139, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0030666, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030659, GO:0045335, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0030866 [BP]cortical actin cytoskeleton organizationconfidentGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030865, GO:0044763, GO:0030036, GO:0008150, GO:0044699, GO:0016043
GO:0031252 [CC]cell leading edgeconfidentGO:0005575, GO:0044464, GO:0005623
GO:0009792 [BP]embryo development ending in birth or egg hatchingconfidentGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005905 [CC]coated pitconfidentGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016331 [BP]morphogenesis of embryonic epitheliumconfidentGO:0048598, GO:0002009, GO:0048856, GO:0044707, GO:0060429, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0030031 [BP]cell projection assemblyconfidentGO:0022607, GO:0030030, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0040010 [BP]positive regulation of growth rateconfidentGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0000001 [BP]mitochondrion inheritanceprobableGO:0006996, GO:0044699, GO:0048311, GO:0048308, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0007005, GO:0051646, GO:0008150, GO:0051179, GO:0051640, GO:0051641
GO:0000147 [BP]actin cortical patch assemblyprobableGO:0006996, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0009987, GO:0030866, GO:0030036, GO:0044085, GO:0044763, GO:0030865, GO:0008150, GO:0071840, GO:0016043
GO:0006887 [BP]exocytosisprobableGO:0046903, GO:0009987, GO:0016192, GO:0006810, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005200 [MF]structural constituent of cytoskeletonprobableGO:0003674, GO:0005198
GO:0044351 [BP]macropinocytosisprobableGO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8K, chain F
Confidence level:very confident
Coverage over the Query: 2-168
View the alignment between query and template
View the model in PyMOL