Diaphorina citri psyllid: psy9055


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MHKLKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQKSSVDRKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPTSTQD
ccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHcccccccccHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccc
*************RFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAY***********KLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQ**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKLKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQKSSVDRKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPTSTQD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DCN1-like protein 1 Part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation. Functions to recruit the NEDD8-charged E2 enzyme to the cullin component. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic in vivo.very confidentQ9QZ73
DCN1-like protein 1 Part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation. Functions to recruit the NEDD8-charged E2 enzyme to the cullin component. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression.very confidentQ96GG9
DCN1-like protein May contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.very confidentQ9VUQ8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000151 [CC]ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TDU, chain A
Confidence level:very confident
Coverage over the Query: 60-141,165-274
View the alignment between query and template
View the model in PyMOL
Template: 3BQ3, chain A
Confidence level:very confident
Coverage over the Query: 6-141,165-272
View the alignment between query and template
View the model in PyMOL