Psyllid ID: psy9055

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MHKLKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQKSSVDRKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPTSTQD
ccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHccccccccHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccc
cccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHEEEEEEEEccHHHHcHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcHHcccccccccccHHHHHHHHHHHHHHccccccccccc
mhklkssqKDKVKRFISFTqtgeltainclsqndwkldlasdnyfqnpsayykeqkssvdrkKLESLYSKykdasepdKILVEGIMKFlddlslspeskLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAElkdnlncdsIEKLKMRLPSLEAELKDNLKFKDFYQFTFnyaknpgqkgldlDMAITYWNIVLQGRFKFLHLWCTFLQehhkrsipkdTWNLLLDFATAtnedmsnydeegawpVLIDDFVEwaqpqvkaanqptstqd
mhklkssqkdkvKRFISftqtgeltainCLSQNDWKLDLASDNYFQNPSAYykeqkssvdrkKLESLYskykdasepdkILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHhkrsipkdTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVkaanqptstqd
MHKLKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQKSSVDRKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPTSTQD
*************RFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAY***************************KILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQ**************
****************SFTQTGELTAINCLSQNDWKLDLASDNYF*****************KLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGC*S*********SLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVE*****************
***********VKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQKSSVDRKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQV***********
******SQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQKSSVDRKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVK**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKLKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQKSSVDRKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPTSTQD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query284 2.2.26 [Sep-21-2011]
Q96GG9259 DCN1-like protein 1 OS=Ho yes N/A 0.904 0.992 0.633 1e-101
Q5ZKU1259 DCN1-like protein 1 OS=Ga no N/A 0.904 0.992 0.633 1e-101
Q9QZ73259 DCN1-like protein 1 OS=Mu yes N/A 0.904 0.992 0.629 1e-100
Q6PH85259 DCN1-like protein 2 OS=Ho no N/A 0.897 0.984 0.616 9e-98
Q8BZJ7259 DCN1-like protein 2 OS=Mu no N/A 0.897 0.984 0.612 3e-96
Q9VUQ8288 DCN1-like protein OS=Dros yes N/A 0.894 0.881 0.609 6e-94
Q54GP1249 DCN1-like protein 1 OS=Di yes N/A 0.876 1.0 0.357 6e-46
Q60YT5367 Defective in cullin neddy N/A N/A 0.823 0.637 0.345 1e-43
Q9U3C8295 Defective in cullin neddy yes N/A 0.873 0.840 0.340 2e-43
Q6DFA1303 DCN1-like protein 3 OS=Xe N/A N/A 0.869 0.815 0.351 2e-34
>sp|Q96GG9|DCNL1_HUMAN DCN1-like protein 1 OS=Homo sapiens GN=DCUN1D1 PE=1 SV=1 Back     alignment and function desciption
 Score =  367 bits (941), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/281 (63%), Positives = 215/281 (76%), Gaps = 24/281 (8%)

Query: 1   MHKLKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQ-KSSV 59
           M+KLKSSQKDKV++F+ FTQ+ E TA++CLSQNDWKLD+A+DN+FQNP  Y +E  K S+
Sbjct: 1   MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSL 60

Query: 60  DRKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRD 119
           DRKKLE LY++YKD  + +KI ++GI +F DDL+L P S  VLIIAW+F+AA QCEFS+ 
Sbjct: 61  DRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQ 120

Query: 120 EFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDF 179
           EFM+GM ELGCDSI                       EKLK ++P +E ELK+  +FKDF
Sbjct: 121 EFMDGMTELGCDSI-----------------------EKLKAQIPKMEQELKEPGRFKDF 157

Query: 180 YQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLL 239
           YQFTFN+AKNPGQKGLDL+MAI YWN+VL GRFKFL LW  FL EHHKRSIPKDTWNLLL
Sbjct: 158 YQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLL 217

Query: 240 DFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPT 280
           DF+T   +DMSNYDEEGAWPVLIDDFVE+A+PQ+      T
Sbjct: 218 DFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTT 258
Part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation. Functions to recruit the NEDD8-charged E2 enzyme to the cullin component. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression.
Homo sapiens (taxid: 9606)
>sp|Q5ZKU1|DCNL1_CHICK DCN1-like protein 1 OS=Gallus gallus GN=DCUN1D1 PE=2 SV=1 Back     alignment and function description
>sp|Q9QZ73|DCNL1_MOUSE DCN1-like protein 1 OS=Mus musculus GN=Dcun1d1 PE=2 SV=1 Back     alignment and function description
>sp|Q6PH85|DCNL2_HUMAN DCN1-like protein 2 OS=Homo sapiens GN=DCUN1D2 PE=1 SV=1 Back     alignment and function description
>sp|Q8BZJ7|DCNL2_MOUSE DCN1-like protein 2 OS=Mus musculus GN=Dcun1d2 PE=2 SV=3 Back     alignment and function description
>sp|Q9VUQ8|DCN1L_DROME DCN1-like protein OS=Drosophila melanogaster GN=CG7427 PE=1 SV=2 Back     alignment and function description
>sp|Q54GP1|DCN1L_DICDI DCN1-like protein 1 OS=Dictyostelium discoideum GN=DDB_G0290025 PE=3 SV=1 Back     alignment and function description
>sp|Q60YT5|DCN1_CAEBR Defective in cullin neddylation protein 1 OS=Caenorhabditis briggsae GN=dcn-1 PE=3 SV=3 Back     alignment and function description
>sp|Q9U3C8|DCN1_CAEEL Defective in cullin neddylation protein 1 OS=Caenorhabditis elegans GN=dcn-1 PE=1 SV=2 Back     alignment and function description
>sp|Q6DFA1|DCNL3_XENLA DCN1-like protein 3 OS=Xenopus laevis GN=dcun1d3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query284
332373372261 unknown [Dendroctonus ponderosae] 0.904 0.984 0.730 1e-114
270007355260 hypothetical protein TcasGA2_TC013916 [T 0.915 1.0 0.718 1e-114
346470365261 hypothetical protein [Amblyomma maculatu 0.894 0.973 0.714 1e-114
345492889258 PREDICTED: DCN1-like protein-like [Nason 0.908 1.0 0.713 1e-113
427796805289 Putative dcn1-like protein 1, partial [R 0.890 0.875 0.724 1e-113
91081929280 PREDICTED: similar to leucine zipper pro 0.911 0.925 0.717 1e-113
322787464253 hypothetical protein SINV_09204 [Solenop 0.887 0.996 0.727 1e-112
332029403256 DCN1-like protein 1 [Acromyrmex echinati 0.887 0.984 0.727 1e-112
241829147262 conserved hypothetical protein [Ixodes s 0.890 0.965 0.713 1e-111
383862657254 PREDICTED: DCN1-like protein 1-like [Meg 0.890 0.996 0.721 1e-111
>gi|332373372|gb|AEE61827.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/282 (73%), Positives = 230/282 (81%), Gaps = 25/282 (8%)

Query: 1   MHKLKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNPSAYYKEQKSSVD 60
           MHKLKSSQ+DKVK+FISFTQTGE TAI CL+QNDWKLDLASDNYFQNP AYYKE +S +D
Sbjct: 1   MHKLKSSQRDKVKKFISFTQTGESTAIYCLTQNDWKLDLASDNYFQNPDAYYKETRS-ID 59

Query: 61  RKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDE 120
           +KKLE LY +YKD +EPDKI V+GIMKFLDDL L PESKLVLI+AW+FKAA QCEFSRDE
Sbjct: 60  KKKLEILYIRYKDPNEPDKISVDGIMKFLDDLGLPPESKLVLIVAWKFKAATQCEFSRDE 119

Query: 121 FMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFY 180
           F+NGM +LGCD+I+                       KLK RLPS+E EL+D  KFKDFY
Sbjct: 120 FINGMTDLGCDTID-----------------------KLKQRLPSMENELRDAFKFKDFY 156

Query: 181 QFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLD 240
           QFTFN+AKNP QKG+DLDMAI YWNIVL+GRFKFL LWCTFLQE+HKRSIPKDTWNLLLD
Sbjct: 157 QFTFNFAKNPNQKGIDLDMAIAYWNIVLKGRFKFLELWCTFLQENHKRSIPKDTWNLLLD 216

Query: 241 FATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPTST 282
           FA   ++DMSNYDEEGAWPVLIDDFVEWA  + K  NQP ST
Sbjct: 217 FAQQISDDMSNYDEEGAWPVLIDDFVEWASSKSK-ENQPHST 257

Source: Dendroctonus ponderosae

Species: Dendroctonus ponderosae

Genus: Dendroctonus

Family: Curculionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270007355|gb|EFA03803.1| hypothetical protein TcasGA2_TC013916 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|346470365|gb|AEO35027.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|345492889|ref|XP_001601855.2| PREDICTED: DCN1-like protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|427796805|gb|JAA63854.1| Putative dcn1-like protein 1, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|91081929|ref|XP_966547.1| PREDICTED: similar to leucine zipper protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322787464|gb|EFZ13552.1| hypothetical protein SINV_09204 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332029403|gb|EGI69357.1| DCN1-like protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|241829147|ref|XP_002414744.1| conserved hypothetical protein [Ixodes scapularis] gi|215508956|gb|EEC18409.1| conserved hypothetical protein [Ixodes scapularis] gi|442746409|gb|JAA65364.1| Putative dcn1-like protein 1 [Ixodes ricinus] Back     alignment and taxonomy information
>gi|383862657|ref|XP_003706800.1| PREDICTED: DCN1-like protein 1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query284
UNIPROTKB|Q96GG9259 DCUN1D1 "DCN1-like protein 1" 0.457 0.501 0.738 1.5e-104
UNIPROTKB|I3L7H0259 DCUN1D1 "Uncharacterized prote 0.457 0.501 0.738 1.5e-104
UNIPROTKB|Q5ZKU1259 DCUN1D1 "DCN1-like protein 1" 0.457 0.501 0.738 3.2e-104
UNIPROTKB|E2QV42262 DCUN1D1 "Uncharacterized prote 0.457 0.496 0.738 5.1e-104
UNIPROTKB|F1NPG9258 DCUN1D1 "DCN1-like protein 1" 0.457 0.503 0.738 1.1e-103
ZFIN|ZDB-GENE-030131-5443282 dcun1d1 "DCN1, defective in cu 0.419 0.421 0.798 7.4e-103
MGI|MGI:2142792259 Dcun1d2 "DCN1, defective in cu 0.524 0.575 0.633 1.8e-99
UNIPROTKB|F1MDM6244 DCUN1D1 "Uncharacterized prote 0.457 0.532 0.738 2e-98
TAIR|locus:2087720250 AT3G12760 "AT3G12760" [Arabido 0.507 0.576 0.395 7.8e-58
ZFIN|ZDB-GENE-040625-171204 dcun1d2 "DCN1, defective in cu 0.461 0.642 0.702 1.6e-47
UNIPROTKB|Q96GG9 DCUN1D1 "DCN1-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 533 (192.7 bits), Expect = 1.5e-104, Sum P(2) = 1.5e-104
 Identities = 96/130 (73%), Positives = 109/130 (83%)

Query:   151 LNCDSIEKLKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQG 210
             L CDSIEKLK ++P +E ELK+  +FKDFYQFTFN+AKNPGQKGLDL+MAI YWN+VL G
Sbjct:   129 LGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNG 188

Query:   211 RFKFLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQ 270
             RFKFL LW  FL EHHKRSIPKDTWNLLLDF+T   +DMSNYDEEGAWPVLIDDFVE+A+
Sbjct:   189 RFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFAR 248

Query:   271 PQVKAANQPT 280
             PQ+      T
Sbjct:   249 PQIAGTKSTT 258
GO:0008150 "biological_process" evidence=ND
GO:0000151 "ubiquitin ligase complex" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|I3L7H0 DCUN1D1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKU1 DCUN1D1 "DCN1-like protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV42 DCUN1D1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPG9 DCUN1D1 "DCN1-like protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5443 dcun1d1 "DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2142792 Dcun1d2 "DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDM6 DCUN1D1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2087720 AT3G12760 "AT3G12760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-171 dcun1d2 "DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9QZ73DCNL1_MOUSENo assigned EC number0.62980.90490.9922yesN/A
Q8BZJ7DCNL2_MOUSENo assigned EC number0.61290.89780.9845noN/A
Q96GG9DCNL1_HUMANNo assigned EC number0.63340.90490.9922yesN/A
Q6FJR2DCN1_CANGANo assigned EC number0.27210.85910.8937yesN/A
Q8WZK4DCN1_SCHPONo assigned EC number0.29110.80280.9083yesN/A
Q9VUQ8DCN1L_DROMENo assigned EC number0.60910.89430.8819yesN/A
Q9U3C8DCN1_CAEELNo assigned EC number0.34010.87320.8406yesN/A
Q750Y3DCN1_ASHGONo assigned EC number0.25610.84150.9372yesN/A
Q5ZKU1DCNL1_CHICKNo assigned EC number0.63340.90490.9922noN/A
Q5AWS1DCN1_EMENINo assigned EC number0.26870.86970.8019yesN/A
Q54GP1DCN1L_DICDINo assigned EC number0.35760.87671.0yesN/A
P0CN06DCN1_CRYNJNo assigned EC number0.28020.83800.8530yesN/A
Q6PH85DCNL2_HUMANNo assigned EC number0.61640.89780.9845noN/A
Q12395DCN1_YEASTNo assigned EC number0.24110.85210.8996yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
pfam03556117 pfam03556, Cullin_binding, Cullin binding 4e-56
>gnl|CDD|217613 pfam03556, Cullin_binding, Cullin binding Back     alignment and domain information 
 Score =  176 bits (448), Expect = 4e-56
 Identities = 69/117 (58%), Positives = 87/117 (74%), Gaps = 2/117 (1%)

Query: 156 IEKLKMRLPSLEAELK-DNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGR-FK 213
           IEKLK +LP L +ELK D  KFKD Y+FTF++A+  GQK LDL+ AI YW ++   R F 
Sbjct: 1   IEKLKAKLPELRSELKSDPEKFKDLYRFTFDFAREEGQKSLDLETAIEYWKLLFGSRTFP 60

Query: 214 FLHLWCTFLQEHHKRSIPKDTWNLLLDFATATNEDMSNYDEEGAWPVLIDDFVEWAQ 270
            L  W  FL+E HK+SI KDTWN+LL+F+   +ED+SNYDEEGAWP LID+FVEW +
Sbjct: 61  LLDQWIEFLEEKHKKSISKDTWNMLLEFSKTIDEDLSNYDEEGAWPSLIDEFVEWLK 117

This domain binds to cullins and to Rbx-1, components of an E3 ubiquitin ligase complex for neddylation. Neddylation is the process by which the C-terminal glycine of the ubiquitin-like protein Nedd8 is covalently linked to lysine residues in a protein through an isopeptide bond. The structure of this domain is composed entirely of alpha helices. Length = 117

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 284
KOG3077|consensus260 100.0
PF03556117 Cullin_binding: Cullin binding; InterPro: IPR00517 100.0
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 99.33
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 97.47
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 97.42
KOG1364|consensus356 96.86
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 96.47
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 95.42
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 95.13
KOG3077|consensus260 94.89
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 93.05
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 92.9
KOG2086|consensus380 92.87
PTZ00184149 calmodulin; Provisional 92.77
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 92.75
cd0005267 EH Eps15 homology domain; found in proteins implic 92.73
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 91.91
PTZ00183158 centrin; Provisional 91.85
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 91.66
PTZ00184149 calmodulin; Provisional 90.21
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 90.09
cd0503088 calgranulins Calgranulins: S-100 domain found in p 89.33
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 88.06
PRK06369115 nac nascent polypeptide-associated complex protein 87.91
PTZ00183158 centrin; Provisional 86.88
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 86.73
smart0054643 CUE Domain that may be involved in binding ubiquit 86.46
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 83.77
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 82.78
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 82.25
cd0021388 S-100 S-100: S-100 domain, which represents the la 80.91
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 80.54
>KOG3077|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-71  Score=503.90  Aligned_cols=258  Identities=48%  Similarity=0.894  Sum_probs=242.0

Q ss_pred             CCCCCcchHHHHHHHHhhhCCCHHHHHHHHHhCCCChHHH-HHhhcCCCccch-hccCCcccHHHHHHHHHHhcCCCCCC
Q psy9055           1 MHKLKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLA-SDNYFQNPSAYY-KEQKSSVDRKKLESLYSKYKDASEPD   78 (284)
Q Consensus         1 m~~l~~~~~~~i~qF~~iT~~s~~~A~~~L~~~~w~l~~A-~~~fy~~~~~~~-~~~~~~~~~~~l~~lFd~Y~d~~~~~   78 (284)
                      |++|+..+...+++|+.+|++++.++..+|++++|++..| .+.||.++.... .+....++.+.++++|.+|+||.+++
T Consensus         1 mnklk~~~~d~~~~~~~~~~~~~~~s~~~~~~~dw~~~~~~~~s~~~~~~~~~~~~~~~~~s~~~l~~~f~~y~d~~d~~   80 (260)
T KOG3077|consen    1 MNKLKSSQKDKFEQFMSFTASRKKTSLSCLAACDWNLKYAFNDSYYTNPQSLREESVQARVSEKRLEELFNQYKDPDDDN   80 (260)
T ss_pred             CCccchhHHHHHHhhcccccccchhhhhhhcccccccchhcccchhcchhHHHHhhhhccccHHHHHHHHHHhcCccccc
Confidence            7889999999999999999999999999999999999999 666666665332 22245678899999999999998888


Q ss_pred             ccCHHHHHHHHHHcCCCCCchHHHHHHHhhcccccccccHHHHHHHHHHhCCCcHHHHHhhccchhHhhhhccccchHHH
Q psy9055          79 KILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDEFMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEK  158 (284)
Q Consensus        79 ~I~~dG~~~~~edLgv~ped~~~LvLa~~l~a~~~g~~tr~eF~~g~~~l~~~si~~lk~~l~~l~~~~~~~~~~~~~~~  158 (284)
                      .|++||+.+||+||||+|+++++|||||+|+|++||+|||++|+.||.++||+|+++|+.+|+                 
T Consensus        81 ~i~~dgi~~fc~dlg~~p~~i~~LvlAwkl~A~~m~~Fsr~ef~~g~~~l~~dS~d~lq~~l~-----------------  143 (260)
T KOG3077|consen   81 LIGPDGIEKFCEDLGVEPEDISVLVLAWKLGAATMCEFSREEFLKGMTALGCDSIDKLQQRLD-----------------  143 (260)
T ss_pred             ccChHHHHHHHHHhCCCchhHHHHHHHHHhccchhhhhhHHHHHHHHHHcCCCcHHHHHHHHH-----------------
Confidence            999999999999999999999999999999999999999999999999999999999999999                 


Q ss_pred             HhhhhhhHHHHhhChhhHHHHHhhhhhcccCCCCCCCCHHHHHHHHHHhhcCCcccHHHHHHHHHhhccCCCChhhhHHH
Q psy9055         159 LKMRLPSLEAELKDNLKFKDFYQFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLL  238 (284)
Q Consensus       159 ~~~~~~~l~~~l~d~~~Fk~~Y~f~F~~~k~~~qk~l~~etAi~~W~lll~~~~~~l~~W~~FL~~~~~k~IskD~W~~~  238 (284)
                            .++..+.|+++|+.+|+|+|+|++++|||+|++++||.||.+||+.++|.|++|++||++..++.|+||||+|+
T Consensus       144 ------~l~~~l~d~~~Fk~iY~faf~fa~e~~qk~Ld~~~ai~~w~ll~~~~~pll~~w~~FL~~~~~~~~~KDtW~~~  217 (260)
T KOG3077|consen  144 ------FLRSVLKDLEKFKSIYRFAFNFAKEPGQKSLDLETAISLWKLLFGQTPPLLDQWIQFLKDSPNRAISKDTWNLL  217 (260)
T ss_pred             ------HHHHHHccHHHhhHHHHhhhhhccCcCcCcCCHHHHHHHHHHHhCCCCchHHHHHHHHHhCcCcccCcccHHHH
Confidence                  88899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcccCCCCCCcCCCchHhHHHHHHHhhHhhhccCCCCC
Q psy9055         239 LDFATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPTS  281 (284)
Q Consensus       239 l~F~~~~~~dls~YDe~~AWP~liDeFVe~~r~~~~~~~~~~~  281 (284)
                      |+|.+++++|+|||||+||||+||||||||+|.+...++++++
T Consensus       218 l~Fs~~i~~dlSnYDeegAWP~liDeFVe~~r~~~~~~~~~~~  260 (260)
T KOG3077|consen  218 LDFSKTIDPDLSNYDEEGAWPVLIDEFVEYLRDKQSNSKSGSS  260 (260)
T ss_pred             HHHHHhcCccccCccccccchHHHHHHHHHHHHhccCCCCCCC
Confidence            9999999999999999999999999999999999777766654

>PF03556 Cullin_binding: Cullin binding; InterPro: IPR005176 The eukaryotic defective in cullin neddylation (DCN) protein family, may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>KOG1364|consensus Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>KOG3077|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG2086|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
3tdu_A200 N-Terminal Acetylation Acts As An Avidity Enhancer 3e-77
4gao_A200 Dcnl Complex With N-terminally Acetylated Nedd8 E2 9e-76
3kev_A199 X-Ray Crystal Structure Of A Dcun1 Domain-Containin 4e-41
4gba_A221 Dcnl Complex With N-terminally Acetylated Nedd8 E2 8e-34
3bq3_A270 Crystal Structure Of S. Cerevisiae Dcn1 Length = 27 4e-19
3o2p_A202 A Dual E3 Mechanism For Rub1 Ligation To Cdc53: Dcn 1e-15
2is9_A204 Structure Of Yeast Dcn-1 Length = 204 5e-15
>pdb|3TDU|A Chain A, N-Terminal Acetylation Acts As An Avidity Enhancer Within An Interconnected Multiprotein Complex: Structure Of A Human Cul1whb- Dcn1p-Acetylated Ubc12n Complex Length = 200 Back     alignment and structure 
Iteration: 1

 Score =  285 bits (728), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 138/220 (62%), Positives = 163/220 (74%), Gaps = 23/220 (10%)
Query: 61  RKKLESLYSKYKDASEPDKILVEGIMKFLDDLSLSPESKLVLIIAWRFKAAAQCEFSRDE 120
           RKKLE LY++YKD  + +KI ++GI +F DDL+L P S  VLIIAW+F+AA QCEFS+ E
Sbjct: 3   RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQE 62
Query: 121 FMNGMLELGCDSIEKLKMRLPSLEAELKDNLNCDSIEKLKMRLPSLEAELKDNLKFKDFY 180
           FM+GM ELGCDSI                       EKLK ++P +E ELK+  +FKDFY
Sbjct: 63  FMDGMTELGCDSI-----------------------EKLKAQIPKMEQELKEPGRFKDFY 99
Query: 181 QFTFNYAKNPGQKGLDLDMAITYWNIVLQGRFKFLHLWCTFLQEHHKRSIPKDTWNLLLD 240
           QFTFN+AKNPGQKGLDL+MAI YWN+VL GRFKFL LW  FL EHHKRSIPKDTWNLLLD
Sbjct: 100 QFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLD 159
Query: 241 FATATNEDMSNYDEEGAWPVLIDDFVEWAQPQVKAANQPT 280
           F+T   +DMSNYDEEGAWPVLIDDFVE+A+PQ+      T
Sbjct: 160 FSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTT 199
>pdb|4GAO|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 200 Back     alignment and structure
>pdb|3KEV|A Chain A, X-Ray Crystal Structure Of A Dcun1 Domain-Containing Protein From Galdieria Sulfuraria Length = 199 Back     alignment and structure
>pdb|4GBA|A Chain A, Dcnl Complex With N-terminally Acetylated Nedd8 E2 Peptide Length = 221 Back     alignment and structure
>pdb|3O2P|A Chain A, A Dual E3 Mechanism For Rub1 Ligation To Cdc53: Dcn1(P)-Cdc53(Whb) Length = 202 Back     alignment and structure
>pdb|2IS9|A Chain A, Structure Of Yeast Dcn-1 Length = 204 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 9e-80
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 4e-79
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 3e-76
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A Length = 200 Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Length = 199 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query284
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 100.0
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 100.0
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 100.0
4gba_A221 DCN1-like protein 3; E3 ligase, ligase-peptide com 100.0
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 99.32
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 99.28
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 99.25
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 99.24
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 99.2
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 97.82
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 97.78
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 97.48
4gew_A362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 97.35
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.07
2l2d_A73 OTU domain-containing protein 7A; UBA fold, struct 96.8
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 96.43
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 96.21
1avs_A90 Troponin C; muscle contraction, calcium-activated, 96.12
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 96.01
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 96.0
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 95.99
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.97
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 95.85
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 95.68
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 95.68
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 95.67
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 95.61
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 95.57
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 95.57
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 95.57
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 95.57
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 95.54
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 95.53
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 95.49
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 95.43
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.19
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 95.17
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 95.15
3fwb_A161 Cell division control protein 31; gene gating, com 95.14
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 95.08
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 95.06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 95.04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 95.03
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 94.88
1y1x_A191 Leishmania major homolog of programmed cell death 94.81
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 94.79
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 94.78
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 94.73
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 94.72
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 94.69
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 94.63
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 94.57
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 94.55
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 94.51
3fwb_A161 Cell division control protein 31; gene gating, com 94.5
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 94.43
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 94.42
3akb_A166 Putative calcium binding protein; EF-hand, metal b 94.41
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 94.4
3li6_A66 Calcium-binding protein; calcium signaling protein 94.34
1wji_A63 Tudor domain containing protein 3; UBA domain, str 94.22
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 94.19
2jnf_A158 Troponin C; stretch activated muscle contraction, 94.13
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 94.13
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 94.11
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 94.07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 94.0
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 93.98
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 93.96
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 93.86
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 93.84
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 93.83
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 93.77
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 93.73
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 93.69
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 93.65
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 93.63
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 93.62
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 93.6
1exr_A148 Calmodulin; high resolution, disorder, metal trans 93.58
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 93.54
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 93.5
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 93.5
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 93.46
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 93.36
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 93.31
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 93.28
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 93.19
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 93.16
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 93.03
2jnf_A158 Troponin C; stretch activated muscle contraction, 93.02
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 93.0
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 92.89
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 92.88
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 92.85
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 92.84
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 92.79
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 92.77
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 92.66
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 92.52
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 92.48
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 92.46
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 92.45
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 92.43
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 92.36
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 92.34
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 92.3
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 92.27
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 92.26
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 92.25
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 92.19
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 92.18
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 92.17
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 92.16
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 92.08
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 92.05
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 92.04
1qjt_A99 EH1, epidermal growth factor receptor substrate su 92.01
1c07_A95 Protein (epidermal growth factor receptor pathway 91.96
1exr_A148 Calmodulin; high resolution, disorder, metal trans 91.73
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 91.73
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 91.65
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 91.57
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 91.56
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 91.54
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 91.53
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 91.52
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 91.52
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 91.51
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 91.5
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 91.45
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 91.42
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 91.42
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 91.33
3akb_A166 Putative calcium binding protein; EF-hand, metal b 91.24
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 91.13
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 91.1
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 91.09
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 91.08
1y1x_A191 Leishmania major homolog of programmed cell death 91.01
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 91.01
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 91.0
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 90.92
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 90.88
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 90.84
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 90.8
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 90.76
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 90.56
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 90.44
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 90.35
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 90.34
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 90.27
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 90.25
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 90.23
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 90.21
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 90.17
2cwb_A108 Chimera of immunoglobulin G binding protein G and 90.07
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 90.03
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 90.0
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 89.99
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 89.99
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 89.86
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 89.81
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 89.8
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 89.76
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 89.69
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 89.68
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 89.63
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 89.56
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 89.42
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 89.38
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 89.38
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 89.33
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 89.3
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 89.25
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 89.22
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 89.16
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 89.15
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 89.11
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 89.09
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 89.03
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 88.73
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 88.71
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 88.59
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 88.51
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 88.5
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 88.49
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 88.32
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 88.21
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 88.11
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 88.05
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 87.92
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 87.73
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 87.56
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 87.51
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 87.37
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 87.1
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 87.03
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 86.93
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 86.84
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 86.82
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 86.79
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 86.71
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 86.69
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 86.48
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 86.38
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 86.14
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 86.06
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 85.92
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 85.85
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 85.2
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 85.11
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 84.95
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 84.84
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 84.8
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 84.78
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 84.22
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 84.09
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 83.96
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 83.79
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 83.77
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 83.67
2hps_A186 Coelenterazine-binding protein with bound coelent; 83.61
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 83.6
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 83.55
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 83.24
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 83.09
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 82.69
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 82.67
2dna_A67 Unnamed protein product; ubiquitin associated doma 81.98
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 81.97
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 81.88
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 81.84
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 81.74
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 81.68
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 81.61
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 81.31
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 81.3
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 81.23
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 81.19
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 81.04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 80.81
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 80.6
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 80.58
2jq6_A139 EH domain-containing protein 1; metal binding prot 80.11
3a4u_B143 Multiple coagulation factor deficiency protein 2; 80.03
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 284
d1v92a_46 a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA- 6e-07
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 46 Back     information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: TAP-C domain-like
domain: NSFL1 (p97 ATPase) cofactor p47, UBA-like domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 43.1 bits (102), Expect = 6e-07
 Identities = 9/44 (20%), Positives = 22/44 (50%)

Query: 4  LKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQN 47
          +   ++D ++ F++ T   E  A   L    W L +A  +++++
Sbjct: 1  MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYED 44

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query284
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 99.46
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 97.84
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 96.98
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.55
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 96.46
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 96.16
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 95.86
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.73
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 95.66
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 95.58
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.57
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 95.52
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 95.48
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 95.42
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 95.4
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 95.3
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 95.25
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.01
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.99
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 94.91
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 94.68
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 94.18
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.17
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.03
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 93.94
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 93.89
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 93.6
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 93.55
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 93.49
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 93.35
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 92.85
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 92.82
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 92.42
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 92.4
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 92.38
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 92.31
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 92.2
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 92.04
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 91.87
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 91.83
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 91.7
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 91.7
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.7
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 91.6
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 91.4
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 91.36
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 91.29
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 91.0
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 90.9
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 90.81
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 90.61
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 90.5
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 90.44
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 90.35
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 90.13
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 90.12
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 90.01
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 89.85
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 89.78
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 89.59
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 89.47
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 89.19
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 88.88
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 87.74
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 87.38
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 87.2
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 87.04
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 86.95
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 86.91
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 86.83
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 85.64
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 84.65
d1olma175 Supernatant protein factor (SPF), N-terminal domai 84.53
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 84.51
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 84.18
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 84.08
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 84.05
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 83.9
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 83.64
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 83.53
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 82.58
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 82.57
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 82.07
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 81.98
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 81.5
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 81.21
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 80.85
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 80.69
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: TAP-C domain-like
domain: NSFL1 (p97 ATPase) cofactor p47, UBA-like domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.46  E-value=2.7e-14  Score=96.13  Aligned_cols=45  Identities=20%  Similarity=0.468  Sum_probs=42.0

Q ss_pred             CCcchHHHHHHHHhhhCCCHHHHHHHHHhCCCChHHHHHhhcCCC
Q psy9055           4 LKSSQKDKVKRFISFTQTGELTAINCLSQNDWKLDLASDNYFQNP   48 (284)
Q Consensus         4 l~~~~~~~i~qF~~iT~~s~~~A~~~L~~~~w~l~~A~~~fy~~~   48 (284)
                      +.++++++|.|||+|||+++++|++||++++|||+.||+.||++.
T Consensus         1 ma~~~~~lI~qF~~iTg~~~~~A~~~Le~~~w~Le~Ai~~yfe~g   45 (46)
T d1v92a_           1 MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDG   45 (46)
T ss_dssp             CTTHHHHHHHHHHHHTCCCHHHHHHHHHHTTSCSHHHHHHHHHTC
T ss_pred             CCccHHHHHHHHHHHHCcCHHHHHHHHHHcCCcHHHHHHHHHhcC
Confidence            356789999999999999999999999999999999999999874
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1olma1 a.5.3.1 (A:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure