Diaphorina citri psyllid: psy9060

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------

MSGGLYPAPLKILDVVRTGIEKGPSAGYEAEAEGFSQLAMTPQSKGLMGLFRAQTECKKNSTKHFKEKAVGDVLVVTLDSPGVKVNSLNSEVMSEIQSILRRIQSDSSIRSAVIISGKPGCFIAGADISMLAACKTADQVKQISKSGQQILSEIESSPKPIVAAISGSCLGGGLEVALACHYRIAVKDKKTGLGLPEVALACHYRIVVKDKKTGLGLPEVMLGLLPGAGGTQRLPKLTALPNVLDMTLTGKTLKADKAKKMGIVDQLVEPLGPGLNHPEERTMEYLEEVAVNTASQLASGKLKINRIKPMIPDKVLDVALKFEFVRNQIFGKAKEKVMKMSGGLYPAPLKSKQGLIFFTASLPCER

ccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccEEEEccEEEEEECccccccccccHHHHHHHHHHHHHHHccccccEEEEECcccccEEEcccHHHHHccccHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHccHHHHHHHHHccccccHHHHHHcccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccc

MSGGLYPAPLKILDVVRTGIEKGPSAGYEAEAEGFSQLAMTPQSKGLMGLFRAQTECKKNSTKHFKEKAVGDVLVVTLDSPGVKVNSLNSEVMSEIQSILRRIQSDSSIRSAVIISGKPGCFIAGADISMLAACKT*DQV*QISKSGQQILSEIESSPKPIVAAISGSCLGGGLEVALACHYRIAVKDKKTGLGLPEVALACHYRIVVKDKKTGLGLPEVMLGLLPGAGGTQRLPKLTALPNVLDMTLTGKTLKADKAKKMGIVDQLVEPLGPGLNHPEERTMEYLEEVAVNTASQLASGKLKINRIKPMIPDKVLDVALKFEFVRNQIFGKAKEKVMKMSGGLYPAPLKSKQGLIFFTASLPC**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Trifunctional enzyme subunit alpha, mitochondrial	Bifunctional subunit.	confident	Q64428
Trifunctional enzyme subunit alpha, mitochondrial	Bifunctional subunit.	confident	Q8BMS1
Trifunctional enzyme subunit alpha, mitochondrial	Bifunctional subunit.	confident	P40939

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0042645 [CC]	mitochondrial nucleoid	probable	GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000062 [MF]	fatty-acyl-CoA binding	probable	GO:0043168, GO:0050662, GO:0043167, GO:0003674, GO:0005488, GO:0048037
GO:0044237 [BP]	cellular metabolic process	probable	GO:0009987, GO:0008150, GO:0008152
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003988 [MF]	acetyl-CoA C-acyltransferase activity	probable	GO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674, GO:0016408
GO:0005743 [CC]	mitochondrial inner membrane	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0071704 [BP]	organic substance metabolic process	probable	GO:0008150, GO:0008152
GO:0016508 [MF]	long-chain-enoyl-CoA hydratase activity	probable	GO:0016835, GO:0016836, GO:0003674, GO:0016829, GO:0003824
GO:0051287 [MF]	NAD binding	probable	GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0009617 [BP]	response to bacterium	probable	GO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2W3P, chain A
Confidence level:very confident
Coverage over the Query: 61-191,214-270,284-358
View the alignment between query and template
View the model in PyMOL

Template: 2NP9, chain A
Confidence level:very confident
Coverage over the Query: 36-189,214-270,284-299
View the alignment between query and template
View the model in PyMOL

Template: 2WTB, chain A
Confidence level:very confident
Coverage over the Query: 2-61
View the alignment between query and template
View the model in PyMOL

Template: 1XX4, chain A
Confidence level:probable
Coverage over the Query: 85-211
View the alignment between query and template
View the model in PyMOL