Diaphorina citri psyllid: psy9061

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10

MPFWCPPGRKSGKGYFVYAKGSKARPVNDGALAILKKYSLQPQSALKDEDLQLRMVSRFVNEAVLCLEETILNSPASPVYDHHLDGNLEPGHSRHVTSH

ccccccccccccccEEEEccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccCECcccccccccccccccccc

MPFWCPPGRKSGKGYFVYAKGSKARPVNDGALAILKKYSLQP**ALKDEDLQLRMVSRFVNEAVLCLEETILNSPASPVYDHHLDGNLEPG********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPFWCPPGRKSGKGYFVYAKGSKARPVNDGALAILKKYSLQPQSALKDEDLQLRMVSRFVNEAVLCLEETILNSPASPVYDHHLDGNLEPGHSRHVTSH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Trifunctional enzyme subunit alpha, mitochondrial	Bifunctional subunit.	confident	P40939
Trifunctional enzyme subunit alpha, mitochondrial	Bifunctional subunit; cannot use crotonyl-CoA or 3-hydroxybutyryl-CoA as substrate.	confident	Q29554

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009617 [BP]	response to bacterium	probable	GO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0003988 [MF]	acetyl-CoA C-acyltransferase activity	probable	GO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674, GO:0016408
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0042645 [CC]	mitochondrial nucleoid	probable	GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005743 [CC]	mitochondrial inner membrane	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WDK, chain A
Confidence level:very confident
Coverage over the Query: 4-96
View the alignment between query and template
View the model in PyMOL