Diaphorina citri psyllid: psy9087


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MKLCQLIACTPVKVIGYFPARAPTIEITRVRHHPVPNRSRNSLRRWRGQTLAPSNTYPGLFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIGT
ccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHccccEEEccccccccccccEEEccccccccEEEEccccccccHHHHHHHHHccc
**LCQLIACTPVKVIGYFPARAPTIEITR*RH************RWRGQTLAPSNTYPGLFHLLAMFSS*********************NYEALLSLAERLG*A**RGLNRYEIESIPSF************SCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLCQLIACTPVKVIGYFPARAPTIEITRVRHHPVPNRSRNSLRRWRGQTLAPSNTYPGLFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RING finger protein 38 confidentQ8BI21
RING finger protein 38 confidentQ9H0F5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0048149 [BP]behavioral response to ethanolprobableGO:1901700, GO:0030534, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0045471, GO:0008150, GO:0042221, GO:0097305, GO:0010033, GO:0044699
GO:0008355 [BP]olfactory learningprobableGO:0032501, GO:0007635, GO:0044707, GO:0042048, GO:0044708, GO:0050896, GO:0007612, GO:0007610, GO:0007611, GO:0008306, GO:0008150, GO:0050890, GO:0050877, GO:0042221, GO:0044699, GO:0003008
GO:0007616 [BP]long-term memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:2001020 [BP]regulation of response to DNA damage stimulusprobableGO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0036126 [CC]sperm flagellumprobableGO:0043231, GO:0031514, GO:0044464, GO:0097223, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X4J, chain A
Confidence level:very confident
Coverage over the Query: 113-169
View the alignment between query and template
View the model in PyMOL