Psyllid ID: psy9087

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MKLCQLIACTPVKVIGYFPARAPTIEITRVRHHPVPNRSRNSLRRWRGQTLAPSNTYPGLFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIGT
ccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHccccEEEccccccccccccEEEccccccccEEEEccccccccHHHHHHHHHccc
cccEEEEEcccEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHcccEEEccccccccccEEEEEEEccccccEEEEcccccHHHHHHHHHHHHccc
mklcqliactpvkvigyfparaptieitrvrhhpvpnrsrnslrrwrgqtlapsntypgLFHLLAmfssaplspysqaelgspdstetvENYEALLSLAERLGeakprglnryeiesipsfkfnaskhqsdqtscvvcmcdfetsqvlrglpcshefhAKCVDKWLKIGT
mklcqliactpvkvigyFPARAptieitrvrhhpvpnrsrnslrrwrGQTLAPSNTYPGLFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQvlrglpcshefhakcvDKWLKIGT
MKLCQLIACTPVKVIGYFPARAPTIEITRVRHHPVPNRSRNSLRRWRGQTLAPSNTYPGLFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIGT
**LCQLIACTPVKVIGYFPARAPTIEITRVRHH***********RWRGQTLAPSNTYPGLFHLLAMFS**************************LL****************YEIE*I**F**********QTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKI**
*******ACTPVKVIGY*****************************************GLFHLLAMFSS*********************NYEALLSLAERLG*A**RGLNRYEIESIPS*************SCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKI**
MKLCQLIACTPVKVIGYFPARAPTIEITRVRHHPVPNRSRNSLRRWRGQTLAPSNTYPGLFHLLAMFSSAPLS**************TVENYEALLSLAERLGEAKPRGLNRYEIESIPSFKFN*********SCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIGT
*KLCQLIACTPVKVIGYFPARAPTIEITR*RH*******RNSLRRWRGQTLAPSNTYPGLFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIGT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLCQLIACTPVKVIGYFPARAPTIEITRVRHHPVPNRSRNSLRRWRGQTLAPSNTYPGLFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query170 2.2.26 [Sep-21-2011]
Q8BI21518 RING finger protein 38 OS yes N/A 0.623 0.204 0.633 3e-33
Q9H0F5515 RING finger protein 38 OS yes N/A 0.623 0.205 0.623 8e-33
Q08CG8448 RING finger protein 44 OS no N/A 0.488 0.185 0.702 3e-30
Q4V7B8350 RING finger protein 44 OS no N/A 0.594 0.288 0.596 8e-30
Q3UHJ8407 RING finger protein 44 OS no N/A 0.635 0.265 0.564 9e-30
Q7L0R7432 RING finger protein 44 OS no N/A 0.6 0.236 0.580 2e-29
Q9LT17340 E3 ubiquitin ligase BIG B yes N/A 0.447 0.223 0.397 3e-11
Q5EAE9 407 RING-H2 finger protein AT no N/A 0.358 0.149 0.483 1e-10
Q5XF85 432 E3 ubiquitin-protein liga no N/A 0.347 0.136 0.45 1e-09
Q9SL78 390 Putative RING-H2 finger p no N/A 0.347 0.151 0.45 3e-09
>sp|Q8BI21|RNF38_MOUSE RING finger protein 38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 Back     alignment and function desciption
 Score =  140 bits (353), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 83/109 (76%), Gaps = 3/109 (2%)

Query: 60  LFHLLAMFSSAP-LSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIESI 118
           L ++L+M    P + P    EL   D    VENYEALL+LAERLGEAKPRGL + +IE +
Sbjct: 392 LPYVLSMLPVPPAVGPTFSFELDVEDGE--VENYEALLNLAERLGEAKPRGLTKADIEQL 449

Query: 119 PSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLK 167
           PS++FN S HQS+QT CVVCMCDFE+ Q+LR LPC+HEFHAKCVDKWLK
Sbjct: 450 PSYRFNPSNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK 498

Mus musculus (taxid: 10090)
>sp|Q9H0F5|RNF38_HUMAN RING finger protein 38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 Back     alignment and function description
>sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 Back     alignment and function description
>sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 Back     alignment and function description
>sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 Back     alignment and function description
>sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 Back     alignment and function description
>sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 Back     alignment and function description
>sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 Back     alignment and function description
>sp|Q5XF85|ATL42_ARATH E3 ubiquitin-protein ligase ATL42 OS=Arabidopsis thaliana GN=ATL42 PE=1 SV=2 Back     alignment and function description
>sp|Q9SL78|ATL12_ARATH Putative RING-H2 finger protein ATL12 OS=Arabidopsis thaliana GN=ATL12 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
307210670 641 RING finger protein 44 [Harpegnathos sal 0.741 0.196 0.728 2e-47
307179492 705 RING finger protein 44 [Camponotus flori 0.741 0.178 0.720 2e-47
332017238 608 RING finger protein 38 [Acromyrmex echin 0.764 0.213 0.678 6e-45
322780920 611 hypothetical protein SINV_09125 [Solenop 0.764 0.212 0.678 7e-45
350397367 690 PREDICTED: hypothetical protein LOC10074 0.741 0.182 0.694 4e-44
340725904 691 PREDICTED: hypothetical protein LOC10065 0.741 0.182 0.694 5e-44
383851749 693 PREDICTED: uncharacterized protein LOC10 0.623 0.152 0.768 8e-43
328779969 692 PREDICTED: hypothetical protein LOC40854 0.664 0.163 0.732 1e-42
380024410 692 PREDICTED: uncharacterized protein LOC10 0.664 0.163 0.732 2e-42
242014475 560 RING finger protein, putative [Pediculus 0.641 0.194 0.763 3e-42
>gi|307210670|gb|EFN87093.1| RING finger protein 44 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/129 (72%), Positives = 101/129 (78%), Gaps = 3/129 (2%)

Query: 40  RNSLRRWRGQTLAPSNTYPG-LFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSL 98
           R    RWRG T  P  TYPG L H LAMFS+ PLSPYSQAEL SPDS    ENYEALLSL
Sbjct: 491 RPRYSRWRGTTPLPPMTYPGYLLHFLAMFSNPPLSPYSQAELSSPDSA--TENYEALLSL 548

Query: 99  AERLGEAKPRGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFH 158
           AERLGEAKPRGL R E+E +PS+KFNA  HQ DQT+CVVCMCDFE  Q LR LPCSHEFH
Sbjct: 549 AERLGEAKPRGLTRAEVEQLPSYKFNAETHQGDQTNCVVCMCDFEALQSLRVLPCSHEFH 608

Query: 159 AKCVDKWLK 167
           +KC+DKWLK
Sbjct: 609 SKCIDKWLK 617

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307179492|gb|EFN67806.1| RING finger protein 44 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332017238|gb|EGI58021.1| RING finger protein 38 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322780920|gb|EFZ10132.1| hypothetical protein SINV_09125 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350397367|ref|XP_003484858.1| PREDICTED: hypothetical protein LOC100746954 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340725904|ref|XP_003401304.1| PREDICTED: hypothetical protein LOC100651818 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383851749|ref|XP_003701394.1| PREDICTED: uncharacterized protein LOC100882833 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328779969|ref|XP_392089.3| PREDICTED: hypothetical protein LOC408543 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380024410|ref|XP_003695990.1| PREDICTED: uncharacterized protein LOC100863582 [Apis florea] Back     alignment and taxonomy information
>gi|242014475|ref|XP_002427915.1| RING finger protein, putative [Pediculus humanus corporis] gi|212512399|gb|EEB15177.1| RING finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
FB|FBgn00377051173 mura "murashka" [Drosophila me 0.623 0.090 0.711 5.1e-37
UNIPROTKB|F1LNX1464 Rnf38 "Protein Rnf38" [Rattus 0.8 0.293 0.560 6.4e-37
UNIPROTKB|F1LPR4517 Rnf38 "Protein Rnf38" [Rattus 0.8 0.263 0.560 6.4e-37
UNIPROTKB|Q5XIX1432 Rnf38 "Rnf38 protein" [Rattus 0.8 0.314 0.560 6.4e-37
RGD|621856432 Rnf38 "ring finger protein 38" 0.8 0.314 0.553 2.7e-36
MGI|MGI:1920719518 Rnf38 "ring finger protein 38" 0.8 0.262 0.553 3.5e-36
UNIPROTKB|F1NND0459 RNF38 "Uncharacterized protein 0.8 0.296 0.546 3.5e-36
UNIPROTKB|Q3SZS9432 RNF38 "Uncharacterized protein 0.8 0.314 0.546 7.2e-36
UNIPROTKB|F1PLL1432 RNF38 "Uncharacterized protein 0.8 0.314 0.546 7.2e-36
UNIPROTKB|B1AM81439 RNF38 "RING finger protein 38" 0.8 0.309 0.546 7.2e-36
FB|FBgn0037705 mura "murashka" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 403 (146.9 bits), Expect = 5.1e-37, Sum P(2) = 5.1e-37
 Identities = 79/111 (71%), Positives = 89/111 (80%)

Query:    58 PG-LFHLLAMFSSAPLSPYSQAELGSPDSTETVENYEALLSLAERLGEAKPRGLNRYEIE 116
             PG L + LAMF   PLSPY+Q +L S D+ ET ENYEALLSLAERLGEAKPRGL R EI+
Sbjct:  1003 PGFLLNFLAMF---PLSPYNQHDLSSGDTNET-ENYEALLSLAERLGEAKPRGLTRNEID 1058

Query:   117 SIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLK 167
              +PS+KFN   H  DQ+SCVVCMCDFE  Q+LR LPCSHEFHAKCVDKWL+
Sbjct:  1059 QLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLR 1109
GO:0005575 "cellular_component" evidence=ND
GO:0008355 "olfactory learning" evidence=IMP
GO:0007611 "learning or memory" evidence=IMP
GO:0008270 "zinc ion binding" evidence=IEA
GO:0048149 "behavioral response to ethanol" evidence=IMP
GO:2001020 "regulation of response to DNA damage stimulus" evidence=IGI
GO:0007616 "long-term memory" evidence=IMP
UNIPROTKB|F1LNX1 Rnf38 "Protein Rnf38" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPR4 Rnf38 "Protein Rnf38" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XIX1 Rnf38 "Rnf38 protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|621856 Rnf38 "ring finger protein 38" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1920719 Rnf38 "ring finger protein 38" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NND0 RNF38 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZS9 RNF38 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLL1 RNF38 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B1AM81 RNF38 "RING finger protein 38" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BI21RNF38_MOUSENo assigned EC number0.63300.62350.2046yesN/A
Q9H0F5RNF38_HUMANNo assigned EC number0.62380.62350.2058yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 4e-09
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 5e-08
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-06
smart0018440 smart00184, RING, Ring finger 3e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 0.001
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 49.7 bits (119), Expect = 4e-09
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 134 SCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKI 168
            C +C+ +FE  + +  LPC H FH +C+DKWL+ 
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRS 36

Length = 46
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 170
KOG4628|consensus348 99.64
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.47
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.11
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.09
PHA02929238 N1R/p28-like protein; Provisional 98.93
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.68
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.65
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.63
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.57
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.47
KOG0802|consensus 543 98.44
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.41
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.39
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.26
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.17
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.12
PHA02926242 zinc finger-like protein; Provisional 98.07
PF1463444 zf-RING_5: zinc-RING finger domain 98.04
KOG0801|consensus205 98.03
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.02
KOG1734|consensus328 97.9
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.76
KOG2930|consensus114 97.68
KOG1493|consensus84 97.66
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.61
KOG0317|consensus293 97.51
KOG0823|consensus 230 97.5
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 97.48
KOG0828|consensus636 97.45
KOG0320|consensus187 97.45
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.33
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.25
KOG0804|consensus 493 97.23
KOG4445|consensus 368 97.16
KOG0825|consensus 1134 96.46
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 96.24
KOG1941|consensus 518 96.13
KOG1814|consensus 445 96.04
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.02
KOG2164|consensus 513 96.02
COG52191525 Uncharacterized conserved protein, contains RING Z 95.92
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.69
KOG1039|consensus 344 95.43
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.32
KOG1952|consensus 950 95.28
KOG2034|consensus911 95.12
KOG1428|consensus 3738 95.09
KOG0827|consensus 465 94.39
KOG0287|consensus 442 94.11
KOG3970|consensus 299 93.91
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 93.86
PHA03096284 p28-like protein; Provisional 90.48
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 89.64
KOG2879|consensus298 89.29
KOG0297|consensus 391 88.41
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 88.17
KOG0978|consensus698 87.78
KOG4265|consensus349 87.75
KOG3268|consensus234 87.41
KOG0311|consensus 381 86.3
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 86.0
COG5152259 Uncharacterized conserved protein, contains RING a 85.97
KOG0309|consensus1081 83.71
KOG2066|consensus846 82.29
KOG1609|consensus 323 81.54
KOG1815|consensus 444 81.02
KOG1812|consensus 384 80.85
KOG1785|consensus 563 80.5
KOG4692|consensus489 80.38
>KOG4628|consensus Back     alignment and domain information 
Probab=99.64  E-value=1.1e-16  Score=135.85  Aligned_cols=62  Identities=32%  Similarity=0.777  Sum_probs=55.0

Q ss_pred             CCCCHHHHHcCCceEeccCCCCCCCCCCccccccccCCCeeeEecCCCcchHHhHHHHHHhC
Q psy9087         108 RGLNRYEIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIG  169 (170)
Q Consensus       108 ~gls~~~i~~lp~~~~~~~~~~~~~~~C~ICle~f~~g~~v~~LPC~H~FH~~CI~~WL~~~  169 (170)
                      ..+.+..+.++|...|.........+.|+||||+|+.||+++.|||+|.||..||++||.++
T Consensus       205 ~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~  266 (348)
T KOG4628|consen  205 NRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQT  266 (348)
T ss_pred             hhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEecCCCchhhccchhhHhhc
Confidence            56889999999999998765443346999999999999999999999999999999999875

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0801|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1609|consensus Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 1e-18
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 1e-04
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%)
Query: 118 IPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLK 167
           +PS++FN + HQS+QT CVVCMCDFE+ Q+LR LPC+HEFHAKCVDKWLK
Sbjct: 9   LPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK 58
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-24
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 5e-17
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-16
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 4e-16
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-13
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-12
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-11
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-10
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-08
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 3e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-04
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 89.3 bits (222), Expect = 2e-24
 Identities = 37/55 (67%), Positives = 45/55 (81%)

Query: 114 EIESIPSFKFNASKHQSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKI 168
               +PS++FN + HQS+QT CVVCMCDFE+ Q+LR LPC+HEFHAKCVDKWLK 
Sbjct: 5   SSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKA 59
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.63
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.58
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.37
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.36
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.35
2ect_A78 Ring finger protein 126; metal binding protein, st 99.3
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.28
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.25
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.22
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.2
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.19
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.13
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.1
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.04
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.03
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.02
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.01
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.94
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.94
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.89
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.87
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.87
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.85
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.8
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.78
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.77
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.77
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.76
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.74
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.71
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.7
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.66
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.64
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.63
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.62
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.61
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.59
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.56
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.55
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.54
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.53
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.49
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.35
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.35
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.34
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.33
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.33
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.32
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.26
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.25
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.24
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.18
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.02
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.96
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.9
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.89
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.81
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.76
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.73
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.63
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.47
2ea5_A68 Cell growth regulator with ring finger domain prot 97.35
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.32
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.28
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.23
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.19
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.98
3nw0_A238 Non-structural maintenance of chromosomes element 96.56
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 95.88
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.94
1we9_A64 PHD finger family protein; structural genomics, PH 92.5
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 91.77
1wil_A89 KIAA1045 protein; ring finger domain, structural g 90.97
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 88.12
1wem_A76 Death associated transcription factor 1; structura 88.09
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.98
2k16_A75 Transcription initiation factor TFIID subunit 3; p 86.35
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 85.36
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 85.35
2yt5_A66 Metal-response element-binding transcription facto 84.97
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 82.51
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 81.62
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 81.4
3o70_A68 PHD finger protein 13; PHF13, structural genomics 80.97
1wew_A78 DNA-binding family protein; structural genomics, P 80.14
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 80.12
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.63  E-value=3.3e-16  Score=108.65  Aligned_cols=65  Identities=23%  Similarity=0.597  Sum_probs=56.8

Q ss_pred             cCCCCCCHHHHHcCCceEeccCCC-CCCCCCCccccccccCCCeeeEecCCCcchHHhHHHHHHhC
Q psy9087         105 AKPRGLNRYEIESIPSFKFNASKH-QSDQTSCVVCMCDFETSQVLRGLPCSHEFHAKCVDKWLKIG  169 (170)
Q Consensus       105 ~~~~gls~~~i~~lp~~~~~~~~~-~~~~~~C~ICle~f~~g~~v~~LPC~H~FH~~CI~~WL~~~  169 (170)
                      ...+|++++.|++||...+..... ..+...|+||+++|..++.+..|||||.||..||..||+.+
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~   77 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKS   77 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTT
T ss_pred             cCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcC
Confidence            446899999999999999876543 34567899999999999999999999999999999999875
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 170
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 7e-09
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 7e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 4e-05
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 4e-04
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 4e-04
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 5e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.001
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 0.002
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 47.6 bits (113), Expect = 7e-09
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 131 DQTSCVVCMCDFETSQVLRGLP-CSHEFHAKCVDKWLK 167
           D   C VC+ + E  +  R LP C H FHA+CVD WL 
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLG 41
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.53
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.24
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.21
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.19
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.17
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.1
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.72
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.66
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.63
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.6
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.58
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.52
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.37
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.3
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.18
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.29
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 94.62
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 93.72
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 91.46
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 89.05
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 81.86
d1wema_76 Death associated transcription factor 1, Datf1 (DI 80.32
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.53  E-value=1.4e-15  Score=95.07  Aligned_cols=40  Identities=45%  Similarity=0.994  Sum_probs=36.4

Q ss_pred             CCCCCccccccccCCCeeeEec-CCCcchHHhHHHHHHhCC
Q psy9087         131 DQTSCVVCMCDFETSQVLRGLP-CSHEFHAKCVDKWLKIGT  170 (170)
Q Consensus       131 ~~~~C~ICle~f~~g~~v~~LP-C~H~FH~~CI~~WL~~~~  170 (170)
                      ++.+|+|||++|+.++.+..+| |+|.||.+||.+||+.++
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~   44 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHS   44 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCC
Confidence            4568999999999999999886 999999999999998864
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure