Psyllid ID: psy9090


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDKKKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQIVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVNCQYKDQELQTMHVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADVTDDKLPKGPRETPDTNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVAANGI
ccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccEEEccEEEEccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEcccccEEEEEHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccEEEEEccccccccccHHHHHccc
ccHHHHHHHHHHHHHHHHHHHHccEEcccccHHHEEEcccccEEEccccccEHHHHHHHcccccccccccccHHHHHHHcccccccccHccHHHHHHEHHHHccccccHHccccHHHHEEccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHcccEEEEEcccEEEEEEccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHccEEEEEccEEEEEccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHccccccEccccccccEEEEEEEccccEEEccEHHHHHHHHcHEEEEccccccccHHHHHHHccccHHHHHHHHcccccccccEEccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHcc
MSEQHIAFILKEIITGMVflhenhvihrdlrgsnvlltkdgevkivdfglsretantfdkkktflgspswmapeimrcghkevdgydnriDVWALGITAielgdgkppfedmhptrALFQivrnpppglyrasnwsQHYVDFIAECleknpehrpymsellehpfitslpendlhlstvncqykdqelqtmHVEDLAALETISEDNIVQELEErhnsknhysfVGDVLLFinpnthlnlygtkyhfkykfksrsdnephiyAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIgnagtpinqnstRHVLYMQVTfgssgklsGAIFWLYQLEKwrvtgnrdplqanFHIFYYFYDAMEAAGELDkyflspgrkyrylradvtddklpkgpretpdtnVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEvefessaentaelanpevaangi
MSEQHIAFILKEIITGMVFLHENHVIHRdlrgsnvlltkdGEVKivdfglsretantfdkkktflgspswmapeIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQIVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVNCQYKDQELQTMHVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRadvtddklpkgpretpdtnvaKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESSaentaelanpevaangi
MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDKKKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQIVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVNCQYKDQELQTMHVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSlkhllkhlIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADVTDDKLPKGPRETPDTNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVAANGI
****HIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDKKKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQIVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVNCQYKDQELQTMHVEDLAALETISEDNIVQELE***NSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADV***************NVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEF********************
MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDKKKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQIVRNP********NWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVNCQYKDQELQT***************************KNHYSFVGDVLLFINPNTH***********************IYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADV**************TNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVAA***
MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDKKKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQIVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVNCQYKDQELQTMHVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADVTDDKLPKGPRETPDTNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVAANGI
MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDKKKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQIVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVNCQYKDQELQTMHVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADVTDDKLPKGPRETPDTNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESS*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDKKKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQIVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVNCQYKDQELQTMHVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADVTDDKLPKGPRETPDTNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVAANGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query488 2.2.26 [Sep-21-2011]
P10676 1501 Neither inactivation nor no N/A 0.987 0.321 0.480 1e-133
Q8NEV4 1616 Myosin-IIIa OS=Homo sapie yes N/A 0.944 0.285 0.387 7e-93
Q8WXR4 1341 Myosin-IIIb OS=Homo sapie no N/A 0.989 0.360 0.373 6e-88
Q1EG27 1305 Myosin-IIIb OS=Mus muscul no N/A 0.989 0.370 0.359 4e-86
Q8K3H5 1613 Myosin-IIIa OS=Mus muscul yes N/A 0.948 0.287 0.384 7e-86
Q23356 1096 Serine/threonine-protein yes N/A 0.348 0.155 0.494 4e-47
P83510 1323 Traf2 and NCK-interacting no N/A 0.368 0.136 0.470 2e-46
Q9UKE5 1360 TRAF2 and NCK-interacting no N/A 0.368 0.132 0.470 3e-46
Q8N4C8 1332 Misshapen-like kinase 1 O no N/A 0.368 0.135 0.481 5e-46
Q9JM52 1308 Misshapen-like kinase 1 O no N/A 0.368 0.137 0.481 6e-46
>sp|P10676|NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster GN=ninaC PE=1 SV=2 Back     alignment and function desciption
 Score =  474 bits (1221), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 246/512 (48%), Positives = 330/512 (64%), Gaps = 30/512 (5%)

Query: 1   MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDK 60
           M E+HIA+I++E     + L+ NHV+HRD+RG N+LLTK+G VK+ DFGLSR+  +T  K
Sbjct: 117 MREEHIAYIIRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGK 176

Query: 61  KKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQ 120
           + T +GSP WMAPE++            R DVWALGIT IEL DGKPPF DMHPTRA+FQ
Sbjct: 177 RGTCIGSPCWMAPEVVSAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQ 236

Query: 121 IVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPEND------- 173
           I+RNPPP L R +NWSQ   DFI+E LEKN E+RP M E++EHPF+T L EN+       
Sbjct: 237 IIRNPPPTLMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDI 296

Query: 174 ---LHLST-VNCQYKDQEL--------------QTMHVEDLAALETISEDNIVQELEERH 215
              L LS  V   YK+ EL              + M+ EDLAALE   ++NI++ L  R 
Sbjct: 297 AEMLELSRDVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRI 356

Query: 216 NSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHHE 275
                YSF+GD+LL +N N     +  ++H KY+FKSRS+N+PHI++VAD AYQDM+HH+
Sbjct: 357 LMGESYSFIGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHK 416

Query: 276 EAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQN 335
           E QHIVL+GE+ +GK+T+ + L+KHL +LG G      ++E  +  I  + NAGTP+N +
Sbjct: 417 EPQHIVLSGESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNND 476

Query: 336 STRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGEL 395
           STR VL   +TFG +GK+SGA+F +Y LEK RV    D  Q NFHIFYYFYD +    +L
Sbjct: 477 STRCVLQYCLTFGKTGKMSGAVFNMYMLEKLRV-ATTDGTQHNFHIFYYFYDFINQQNQL 535

Query: 396 DKYFLSPGRKYRYLRA--DVTDDKLPKGPRETPDTNVAKFQEIYQNLIDIEFDDIQMEIF 453
            +Y L   R YRYLR   +V   KL K  R+ P+ NV +++E    L DI+F+  Q+E  
Sbjct: 536 KEYNLKADRNYRYLRVPPEVPPSKL-KYRRDDPEGNVERYREFENILRDIDFNHKQLETV 594

Query: 454 SNVLAAILLIGEVEFESSAENTAELANPEVAA 485
             VLAAIL IG + F  + +  AE+ N ++ +
Sbjct: 595 RKVLAAILNIGNIRFRQNGK-YAEVENTDIVS 625




Required for photoreceptor cell function. The ninaC proteins combines putative serine/threonine-protein kinase and myosin activities.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 Back     alignment and function description
>sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 Back     alignment and function description
>sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 Back     alignment and function description
>sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 Back     alignment and function description
>sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 Back     alignment and function description
>sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 Back     alignment and function description
>sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 Back     alignment and function description
>sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
340709079 1586 PREDICTED: neither inactivation nor afte 0.987 0.303 0.533 1e-157
340709081 1589 PREDICTED: neither inactivation nor afte 0.987 0.303 0.533 1e-157
380016490 1349 PREDICTED: neither inactivation nor afte 0.987 0.357 0.527 1e-157
328792346 1587 PREDICTED: neither inactivation nor afte 0.987 0.303 0.525 1e-157
350419389 1589 PREDICTED: neither inactivation nor afte 0.987 0.303 0.533 1e-157
332020102 1571 Neither inactivation nor afterpotential 0.983 0.305 0.527 1e-156
383865054 1583 PREDICTED: neither inactivation nor afte 0.987 0.304 0.526 1e-156
158298612 1581 AGAP009730-PA [Anopheles gambiae str. PE 0.981 0.302 0.537 1e-153
170040124 1557 myosin IIIA [Culex quinquefasciatus] gi| 0.989 0.310 0.529 1e-153
322788655 1553 hypothetical protein SINV_08357 [Solenop 0.989 0.311 0.519 1e-152
>gi|340709079|ref|XP_003393142.1| PREDICTED: neither inactivation nor afterpotential protein C-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/512 (53%), Positives = 360/512 (70%), Gaps = 30/512 (5%)

Query: 1   MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDK 60
           M E+HI FILKE+I  MV+L+E++V+HRD+RGSN+LLT++GEVK+VDFGLS+       K
Sbjct: 153 MREEHIGFILKEVIQAMVYLNEHNVMHRDIRGSNILLTREGEVKLVDFGLSKMFQGEMGK 212

Query: 61  KKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQ 120
           + T +GSPSWMAPE+        +GY +R DVWA+GITAIEL DGKPPF+DMHPTRALFQ
Sbjct: 213 RYTCIGSPSWMAPEVAMSKGNSSEGYGSRADVWAVGITAIELADGKPPFQDMHPTRALFQ 272

Query: 121 IVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLS--- 177
           IVRNPPP LYR SNWSQ++ DFIAECLEKNPE+RP+M+E+ EHPF+     ND  L+   
Sbjct: 273 IVRNPPPNLYRPSNWSQNFNDFIAECLEKNPENRPFMAEIAEHPFLADSSANDFLLAKEI 332

Query: 178 ----TVNC-------------------QYKDQELQTMHVEDLAALETISEDNIVQELEER 214
               T  C                    ++   L+ M +EDLAALET++ED I+ EL ER
Sbjct: 333 KILMTDVCAKGKHVRRPEVIVRKGFLKTHQTDPLEPMFMEDLAALETLTEDTILDELHER 392

Query: 215 HNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDMMHH 274
                ++SF+GD+LL +NPN   ++YG+ YH KY+FKSRSDN PHIY+VADSAYQD++H+
Sbjct: 393 LRQGYYHSFIGDILLILNPNEQQDIYGSDYHTKYQFKSRSDNAPHIYSVADSAYQDVLHN 452

Query: 275 EEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVGEKIEKCVNVIHAIGNAGTPINQ 334
           EEAQHI+LAGE+ +GKTT+L HL++HL++LG+    +G ++ + + VIHA  NA TP+N 
Sbjct: 453 EEAQHILLAGESNSGKTTNLMHLVRHLMYLGKSLQDIGARLMRAIKVIHAFSNAATPLNP 512

Query: 335 NSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGE 394
           NSTR VL ++ T+GSSGK SGAIFWLYQLEKWRV+  RD  Q+NFH+ YYFYD ++A  +
Sbjct: 513 NSTRCVLELETTYGSSGKASGAIFWLYQLEKWRVS-TRDRNQSNFHVLYYFYDGLDAISK 571

Query: 395 LDKYFLSPGRKYRYLRADV--TDDKLPKGPRETPDTNVAKFQEIYQNLIDIEFDDIQMEI 452
           L +Y L PGR+ RYLR     T+ K     R  P  NVAKF+E+ +NL  +E ++   E 
Sbjct: 572 LKQYHLPPGRRMRYLRISEKGTERKRSFKVRNDPRGNVAKFEELKENLTILEMEEY-CET 630

Query: 453 FSNVLAAILLIGEVEFESSAENTAELANPEVA 484
              +LAAIL +GE+ F       A++ N + A
Sbjct: 631 IWRILAAILNLGEIRFVEGNNGEADMDNNDAA 662




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340709081|ref|XP_003393143.1| PREDICTED: neither inactivation nor afterpotential protein C-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380016490|ref|XP_003692216.1| PREDICTED: neither inactivation nor afterpotential protein C-like [Apis florea] Back     alignment and taxonomy information
>gi|328792346|ref|XP_393429.3| PREDICTED: neither inactivation nor afterpotential protein C isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|350419389|ref|XP_003492164.1| PREDICTED: neither inactivation nor afterpotential protein C-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332020102|gb|EGI60548.1| Neither inactivation nor afterpotential protein C [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383865054|ref|XP_003707990.1| PREDICTED: neither inactivation nor afterpotential protein C-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|158298612|ref|XP_318814.4| AGAP009730-PA [Anopheles gambiae str. PEST] gi|157013968|gb|EAA14178.4| AGAP009730-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170040124|ref|XP_001847861.1| myosin IIIA [Culex quinquefasciatus] gi|167863673|gb|EDS27056.1| myosin IIIA [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|322788655|gb|EFZ14256.1| hypothetical protein SINV_08357 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
FB|FBgn0002938 1501 ninaC "neither inactivation no 0.696 0.226 0.415 4.2e-120
UNIPROTKB|E2RQX5 1613 MYO3A "Uncharacterized protein 0.379 0.114 0.497 2.2e-83
UNIPROTKB|F5H0U9664 MYO3A "Myosin-IIIa" [Homo sapi 0.360 0.265 0.522 2.5e-83
UNIPROTKB|Q8NEV4 1616 MYO3A "Myosin-IIIa" [Homo sapi 0.360 0.108 0.522 2.7e-83
UNIPROTKB|F1RTW9596 MYO3A "Uncharacterized protein 0.360 0.295 0.502 1.7e-82
UNIPROTKB|E1C7H7 1624 MYO3A "Uncharacterized protein 0.411 0.123 0.475 3.2e-82
RGD|1560083 1614 Myo3a "myosin IIIA" [Rattus no 0.379 0.114 0.491 4.1e-82
UNIPROTKB|E1BP01 1626 MYO3A "Uncharacterized protein 0.360 0.108 0.508 8.7e-82
UNIPROTKB|E1C190 1119 MYO3B "Uncharacterized protein 0.360 0.157 0.482 1.2e-81
ZFIN|ZDB-GENE-041026-4 1775 myo3a "myosin IIIA" [Danio rer 0.448 0.123 0.445 1.9e-81
FB|FBgn0002938 ninaC "neither inactivation nor afterpotential C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 669 (240.6 bits), Expect = 4.2e-120, Sum P(2) = 4.2e-120
 Identities = 145/349 (41%), Positives = 214/349 (61%)

Query:   142 FIAECLEKNPEHRPYMSELLE--HPFITSLPENDLHLSTVNCQYKDQELQTMHVEDLAAL 199
             F+ E +E   E R  ++E+LE      T   E +L +     +  D++ + M+ EDLAAL
Sbjct:   281 FLTELIENEDEMRSDIAEMLELSRDVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAAL 340

Query:   200 ETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPH 259
             E   ++NI++ L  R      YSF+GD+LL +N N     +  ++H KY+FKSRS+N+PH
Sbjct:   341 ENPVDENIIESLRHRILMGESYSFIGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPH 400

Query:   260 IYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSXXXXXXXXIFLGQGAAKVGEKIEKCV 319
             I++VAD AYQDM+HH+E QHIVL+GE+ +GK+T+         +LG G      ++E  +
Sbjct:   401 IFSVADIAYQDMLHHKEPQHIVLSGESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSI 460

Query:   320 NVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANF 379
               I  + NAGTP+N +STR VL   +TFG +GK+SGA+F +Y LEK RV    D  Q NF
Sbjct:   461 KAILMLVNAGTPVNNDSTRCVLQYCLTFGKTGKMSGAVFNMYMLEKLRVA-TTDGTQHNF 519

Query:   380 HIFYYFYDAMEAAGELDKYFLSPGRKYRYLRA--DVTDDKLPKGPRETPDTNVAKFQEIY 437
             HIFYYFYD +    +L +Y L   R YRYLR   +V   KL K  R+ P+ NV +++E +
Sbjct:   520 HIFYYFYDFINQQNQLKEYNLKADRNYRYLRVPPEVPPSKL-KYRRDDPEGNVERYRE-F 577

Query:   438 QNLI-DIEFDDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVAA 485
             +N++ DI+F+  Q+E    VLAAIL IG + F  + +  AE+ N ++ +
Sbjct:   578 ENILRDIDFNHKQLETVRKVLAAILNIGNIRFRQNGKY-AEVENTDIVS 625


GO:0007604 "phototransduction, UV" evidence=IMP
GO:0007603 "phototransduction, visible light" evidence=IMP
GO:0004672 "protein kinase activity" evidence=ISS
GO:0016461 "unconventional myosin complex" evidence=ISS;NAS
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS;NAS;IDA
GO:0016028 "rhabdomere" evidence=IDA
GO:0007010 "cytoskeleton organization" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0008104 "protein localization" evidence=IMP;TAS
GO:0005516 "calmodulin binding" evidence=IMP;TAS
GO:0016062 "adaptation of rhodopsin mediated signaling" evidence=IMP;TAS
GO:0016059 "deactivation of rhodopsin mediated signaling" evidence=IMP;TAS
GO:0016027 "inaD signaling complex" evidence=TAS;IPI
GO:0042385 "myosin III complex" evidence=NAS
GO:0005856 "cytoskeleton" evidence=NAS
GO:0004702 "receptor signaling protein serine/threonine kinase activity" evidence=NAS
GO:0006468 "protein phosphorylation" evidence=IEA;NAS
GO:0016459 "myosin complex" evidence=IEA;ISS
GO:0042623 "ATPase activity, coupled" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0003774 "motor activity" evidence=IEA
GO:0035091 "phosphatidylinositol binding" evidence=IDA
GO:0006886 "intracellular protein transport" evidence=IMP
GO:0033227 "dsRNA transport" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|E2RQX5 MYO3A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F5H0U9 MYO3A "Myosin-IIIa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NEV4 MYO3A "Myosin-IIIa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTW9 MYO3A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7H7 MYO3A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1560083 Myo3a "myosin IIIA" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP01 MYO3A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C190 MYO3B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041026-4 myo3a "myosin IIIA" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.737
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 9e-96
cd00124 679 cd00124, MYSc, Myosin motor domain 9e-77
smart00242 677 smart00242, MYSc, Myosin 9e-72
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-71
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-68
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 6e-65
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 1e-64
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 2e-63
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 5e-62
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 1e-61
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 3e-61
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-60
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 1e-59
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 2e-57
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 7e-55
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-54
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 9e-51
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-50
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-49
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 1e-48
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-48
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 8e-47
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 2e-45
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 2e-45
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-45
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 4e-45
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 1e-44
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 4e-44
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 1e-43
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-43
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 6e-43
pfam00069260 pfam00069, Pkinase, Protein kinase domain 9e-43
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-40
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 1e-39
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-39
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 3e-39
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 3e-39
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-39
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 2e-38
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 2e-38
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 7e-38
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 9e-38
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-37
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 3e-37
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-36
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 3e-36
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 3e-36
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 3e-36
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 4e-36
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 3e-35
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 8e-35
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 2e-34
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 7e-34
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 9e-34
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 5e-33
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 1e-32
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-32
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 4e-32
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 1e-31
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-31
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 3e-31
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 3e-31
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 2e-30
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 3e-30
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 4e-30
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-29
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 7e-29
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 9e-29
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 9e-29
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 4e-28
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 6e-28
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 3e-27
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 3e-27
cd01386 767 cd01386, MYSc_type_XVIII, Myosin motor domain, typ 6e-27
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 1e-26
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-26
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 4e-26
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 6e-26
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 7e-26
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 8e-26
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 9e-26
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 9e-26
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 7e-25
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 9e-25
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 1e-24
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 1e-24
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 4e-24
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 6e-24
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-23
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 3e-23
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 4e-23
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 7e-23
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 8e-23
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 1e-22
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 1e-22
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 6e-22
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 1e-21
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 1e-21
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 2e-21
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-21
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 4e-21
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 7e-21
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 1e-20
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-20
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-20
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-20
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 2e-20
cd08227327 cd08227, PK_STRAD_alpha, Pseudokinase domain of ST 3e-20
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 3e-20
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 3e-20
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 6e-20
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 7e-20
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 7e-20
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 8e-20
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 9e-20
cd08226328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 1e-19
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 1e-19
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 1e-19
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-19
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 2e-19
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 2e-19
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 3e-19
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 5e-19
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 6e-19
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 8e-19
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 1e-18
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 1e-18
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 1e-18
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-18
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 2e-18
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-18
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-18
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 2e-18
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 3e-18
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 4e-18
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 4e-18
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 5e-18
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 6e-18
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 7e-18
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 1e-17
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-17
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 2e-17
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 7e-17
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 8e-17
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-16
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 2e-16
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 3e-16
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 3e-16
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 3e-16
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 6e-16
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 6e-16
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 7e-16
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 8e-16
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-16
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 9e-16
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 1e-15
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 1e-15
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-15
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 3e-15
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 5e-15
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 9e-15
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 1e-14
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 1e-14
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 1e-14
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 1e-14
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 2e-14
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 2e-14
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 2e-14
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 3e-14
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 3e-14
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 3e-14
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 4e-14
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 4e-14
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 4e-14
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 5e-14
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 6e-14
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 6e-14
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 6e-14
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 7e-14
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 7e-14
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 9e-14
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 1e-13
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-13
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 2e-13
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 2e-13
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 2e-13
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 3e-13
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 3e-13
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 4e-13
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 4e-13
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 6e-13
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 6e-13
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 7e-13
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 8e-13
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 9e-13
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 9e-13
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 1e-12
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-12
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 1e-12
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 1e-12
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 1e-12
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 2e-12
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 2e-12
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 2e-12
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 2e-12
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 2e-12
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 3e-12
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 3e-12
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 3e-12
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 3e-12
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 3e-12
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 4e-12
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 4e-12
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 4e-12
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 5e-12
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 6e-12
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 6e-12
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 7e-12
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 1e-11
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 1e-11
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 1e-11
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 1e-11
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 1e-11
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 1e-11
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-11
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 2e-11
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 2e-11
smart00750176 smart00750, KIND, kinase non-catalytic C-lobe doma 2e-11
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 3e-11
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 3e-11
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 4e-11
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 4e-11
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 4e-11
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 5e-11
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 5e-11
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 6e-11
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 7e-11
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 7e-11
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 7e-11
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 8e-11
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 9e-11
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 1e-10
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 1e-10
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 1e-10
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 1e-10
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 1e-10
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 1e-10
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 1e-10
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 2e-10
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-10
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 2e-10
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 3e-10
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 3e-10
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 5e-10
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 5e-10
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 5e-10
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 6e-10
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 7e-10
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 8e-10
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 8e-10
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 8e-10
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 9e-10
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 1e-09
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-09
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 2e-09
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 2e-09
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 2e-09
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 3e-09
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 3e-09
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 3e-09
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 3e-09
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 3e-09
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 3e-09
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 4e-09
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 4e-09
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 5e-09
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 5e-09
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 7e-09
cd05086268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 8e-09
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 8e-09
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 8e-09
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 8e-09
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 9e-09
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 9e-09
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 1e-08
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 1e-08
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 1e-08
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 2e-08
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 3e-08
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 3e-08
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 6e-08
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 6e-08
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 6e-08
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 9e-08
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 1e-07
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 1e-07
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 1e-07
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 1e-07
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 1e-07
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 1e-07
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 5e-07
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 5e-07
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 5e-07
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 1e-06
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 1e-06
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 1e-06
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 2e-06
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 2e-06
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 2e-06
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 2e-06
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 2e-06
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 4e-06
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 7e-06
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 9e-06
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 9e-06
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 3e-05
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 4e-05
PRK14879211 PRK14879, PRK14879, serine/threonine protein kinas 2e-04
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 3e-04
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 3e-04
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 8e-04
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 0.001
COG3642204 COG3642, COG3642, Mn2+-dependent serine/threonine 0.004
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
 Score =  290 bits (744), Expect = 9e-96
 Identities = 98/166 (59%), Positives = 126/166 (75%)

Query: 1   MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDK 60
           + E+ IA+IL+E + G+ +LHEN VIHRD++G N+LLTK+ EVK+VDFG+S +  +T  +
Sbjct: 110 LKEEWIAYILRETLRGLAYLHENKVIHRDIKGQNILLTKNAEVKLVDFGVSAQLDSTLGR 169

Query: 61  KKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQ 120
           + TF+G+P WMAPE++ C  +    YD R DVW+LGITAIEL DGKPP  DMHP RALF+
Sbjct: 170 RNTFIGTPYWMAPEVIACDEQPDASYDARSDVWSLGITAIELADGKPPLCDMHPMRALFK 229

Query: 121 IVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFI 166
           I RNPPP L    NWS+ + DFI+ECL KN E RP+M ELLEHPFI
Sbjct: 230 IPRNPPPTLKSPENWSKKFNDFISECLIKNYEQRPFMEELLEHPFI 275


Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin III may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. It may also function as a cargo carrier during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. The Drosophila class III myosin, called NinaC (Neither inactivation nor afterpotential protein C), is critical in normal adaptation and termination of photoresponse. Vertebrates contain two isoforms of class III myosin, IIIA and IIIB. This subfamily also includes mammalian NIK-like embryo-specific kinase (NESK), Traf2- and Nck-interacting kinase (TNIK), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated either by a small GTP-binding protein or by an adaptor protein, which transmits the signal either directly to a MAP3K to start the triple kinase core cascade or indirectly through a mediator kinase, a MAP4K. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Length = 275

>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|214801 smart00750, KIND, kinase non-catalytic C-lobe domain Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|237847 PRK14879, PRK14879, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|226168 COG3642, COG3642, Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 488
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
KOG0164|consensus 1001 100.0
PTZ00014 821 myosin-A; Provisional 100.0
KOG0162|consensus 1106 100.0
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 100.0
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 100.0
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 100.0
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 100.0
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 100.0
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 100.0
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 100.0
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 100.0
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 100.0
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 100.0
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 100.0
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 100.0
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 100.0
KOG0163|consensus 1259 100.0
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 100.0
KOG0161|consensus 1930 100.0
KOG0160|consensus 862 100.0
KOG4229|consensus 1062 100.0
KOG0598|consensus357 100.0
KOG0616|consensus355 100.0
KOG0581|consensus364 100.0
KOG0615|consensus475 100.0
KOG0575|consensus592 100.0
KOG0592|consensus604 100.0
KOG0694|consensus694 100.0
KOG0033|consensus355 100.0
KOG0578|consensus550 100.0
KOG0605|consensus550 100.0
KOG0599|consensus411 100.0
KOG0593|consensus396 100.0
KOG0588|consensus 786 100.0
KOG0583|consensus370 100.0
KOG0690|consensus516 100.0
KOG0579|consensus 1187 100.0
KOG0661|consensus538 100.0
KOG0198|consensus313 100.0
KOG0582|consensus516 100.0
KOG0659|consensus318 100.0
KOG0604|consensus400 99.98
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.98
KOG0594|consensus323 99.98
KOG0663|consensus419 99.98
KOG0660|consensus359 99.97
KOG0696|consensus683 99.97
KOG0201|consensus467 99.97
KOG0591|consensus375 99.97
KOG0600|consensus560 99.97
KOG0610|consensus459 99.97
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.97
KOG0597|consensus 808 99.97
KOG0986|consensus591 99.97
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.97
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.97
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.97
KOG0658|consensus364 99.97
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.97
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.97
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
KOG0585|consensus576 99.97
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.97
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.97
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.97
KOG0614|consensus732 99.97
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.97
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.97
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.97
KOG0695|consensus593 99.97
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.97
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.97
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.97
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.97
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.97
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.97
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.97
KOG4717|consensus 864 99.97
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
PTZ00036440 glycogen synthase kinase; Provisional 99.97
KOG0612|consensus 1317 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.97
KOG0032|consensus382 99.97
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.97
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.97
KOG0983|consensus391 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.97
KOG0595|consensus429 99.97
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.96
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.96
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.96
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.96
KOG0574|consensus502 99.96
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.96
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.96
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.96
KOG0580|consensus281 99.96
KOG0603|consensus612 99.96
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.96
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.96
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.96
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.96
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.96
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.96
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.96
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.96
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.96
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.96
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.96
PTZ00284467 protein kinase; Provisional 99.96
KOG0589|consensus426 99.96
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.96
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.96
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.96
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.96
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.96
PHA03212391 serine/threonine kinase US3; Provisional 99.96
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.96
KOG0596|consensus677 99.96
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.96
KOG0611|consensus668 99.96
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.96
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.96
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.96
PTZ00283496 serine/threonine protein kinase; Provisional 99.96
PHA03207392 serine/threonine kinase US3; Provisional 99.96
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.96
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.96
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
KOG0577|consensus 948 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.96
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.96
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.96
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.96
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.96
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.96
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
KOG0192|consensus362 99.96
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.96
PHA03209357 serine/threonine kinase US3; Provisional 99.96
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.96
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
KOG4279|consensus1226 99.96
KOG0667|consensus586 99.95
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.95
PTZ00267478 NIMA-related protein kinase; Provisional 99.95
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.95
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.95
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.95
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.95
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.95
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.95
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.95
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.95
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.95
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.95
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.95
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.95
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.95
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.95
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.95
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.95
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.95
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.95
PHA03211461 serine/threonine kinase US3; Provisional 99.95
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.95
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.95
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.95
KOG0587|consensus 953 99.95
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.95
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.95
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.95
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.95
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.95
KOG0608|consensus1034 99.95
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.95
KOG0607|consensus463 99.95
PHA03210501 serine/threonine kinase US3; Provisional 99.95
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.95
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.95
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.95
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.95
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.95
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.95
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.95
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.95
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.95
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.95
KOG0671|consensus415 99.95
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.95
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.95
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.94
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.94
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.94
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.94
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.94
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.94
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.94
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.94
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.94
PLN00009294 cyclin-dependent kinase A; Provisional 99.94
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.94
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.94
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.94
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.94
PHA02882294 putative serine/threonine kinase; Provisional 99.94
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.94
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.94
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.94
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.94
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.94
KOG0665|consensus369 99.94
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.94
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.94
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.94
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.94
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.94
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.94
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.94
KOG0584|consensus632 99.94
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.94
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.94
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.94
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.94
KOG0662|consensus292 99.94
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.94
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.94
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.94
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.94
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.94
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.94
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.94
KOG4721|consensus 904 99.94
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.94
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.94
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.94
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.94
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.94
KOG4645|consensus1509 99.94
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.94
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.94
KOG0666|consensus438 99.94
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.94
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.94
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.94
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.94
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.94
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.94
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.94
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.94
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.94
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.94
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.94
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.94
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.94
PHA02988283 hypothetical protein; Provisional 99.94
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.94
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.94
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.94
KOG0669|consensus376 99.94
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.94
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.94
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.94
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.93
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.93
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.93
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.93
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.93
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.93
KOG1006|consensus361 99.93
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.93
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.93
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.93
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.93
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.93
KOG0197|consensus468 99.93
KOG2345|consensus302 99.93
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.93
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.93
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.93
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.93
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.93
KOG0193|consensus678 99.93
KOG1989|consensus 738 99.93
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.93
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.93
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.93
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.93
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.93
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.93
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.93
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.93
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.93
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.93
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.93
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.93
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.93
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.93
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.93
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.93
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.93
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.93
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.93
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.93
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.93
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.93
KOG4236|consensus888 99.93
KOG0586|consensus596 99.93
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.93
PLN00181 793 protein SPA1-RELATED; Provisional 99.93
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.93
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.93
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.93
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.93
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.93
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.93
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.93
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.93
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.93
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.93
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.93
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.93
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.93
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.93
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.93
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.93
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.92
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.92
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.92
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.92
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.92
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.92
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.92
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.92
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.92
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.92
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.92
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.92
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.92
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.92
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.92
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.92
KOG1035|consensus 1351 99.92
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.92
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.92
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.92
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.92
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.92
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.92
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.92
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.92
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.92
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.92
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.92
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.92
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.92
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.92
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.92
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.92
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.92
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.92
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.91
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.91
KOG0668|consensus338 99.91
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.91
KOG1027|consensus903 99.91
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.91
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.91
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.91
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.91
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.91
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.91
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.91
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.91
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.91
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.91
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.91
KOG0664|consensus449 99.91
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.91
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.91
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.91
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.91
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.9
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.9
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.9
KOG0670|consensus752 99.9
PLN03224507 probable serine/threonine protein kinase; Provisio 99.9
KOG1026|consensus774 99.89
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.89
KOG0984|consensus282 99.89
KOG1151|consensus775 99.89
KOG1095|consensus1025 99.88
KOG0194|consensus474 99.86
KOG4257|consensus974 99.86
KOG0576|consensus 829 99.85
KOG1187|consensus361 99.85
KOG4250|consensus 732 99.84
KOG0199|consensus 1039 99.84
KOG0200|consensus609 99.83
KOG1167|consensus418 99.83
KOG0590|consensus601 99.83
KOG1290|consensus590 99.82
KOG0606|consensus 1205 99.82
KOG1024|consensus563 99.82
KOG1345|consensus378 99.81
KOG0196|consensus996 99.81
KOG4278|consensus 1157 99.8
KOG1094|consensus807 99.8
KOG0603|consensus612 99.79
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.78
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.77
KOG1025|consensus1177 99.76
KOG1152|consensus772 99.75
KOG3653|consensus534 99.73
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.71
KOG2052|consensus513 99.69
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.67
KOG1240|consensus 1431 99.66
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.66
KOG4158|consensus598 99.64
KOG1033|consensus516 99.59
KOG1164|consensus322 99.57
KOG1165|consensus449 99.4
KOG1163|consensus341 99.38
KOG1023|consensus484 99.38
KOG0590|consensus601 99.37
KOG0606|consensus1205 99.3
KOG0195|consensus448 99.29
PRK12274218 serine/threonine protein kinase; Provisional 99.27
PRK09188365 serine/threonine protein kinase; Provisional 99.21
KOG2137|consensus 700 99.11
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.07
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.03
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.02
KOG1166|consensus974 99.0
KOG1266|consensus458 98.93
KOG0601|consensus524 98.87
smart00090237 RIO RIO-like kinase. 98.74
COG4248637 Uncharacterized protein with protein kinase and he 98.63
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.61
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.6
PRK10345210 hypothetical protein; Provisional 98.55
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.54
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 98.45
KOG1243|consensus 690 98.43
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.39
PRK14879211 serine/threonine protein kinase; Provisional 98.37
KOG0601|consensus524 98.34
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.3
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.26
KOG0027|consensus151 98.1
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.04
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.0
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 97.86
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 97.81
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 97.8
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 97.76
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.63
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 97.58
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 97.47
KOG3087|consensus229 97.47
KOG3741|consensus655 97.43
PRK09902216 hypothetical protein; Provisional 97.08
KOG1035|consensus 1351 97.06
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 97.05
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 97.03
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 96.95
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 96.66
KOG0576|consensus829 96.63
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 96.4
COG0478304 RIO-like serine/threonine protein kinase fused to 96.37
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 96.32
KOG0044|consensus193 96.13
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 95.92
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 95.83
COG1718268 RIO1 Serine/threonine protein kinase involved in c 95.73
PTZ00183158 centrin; Provisional 95.69
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 95.62
PTZ00184149 calmodulin; Provisional 95.55
cd0005267 EH Eps15 homology domain; found in proteins implic 95.53
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 95.48
KOG0028|consensus172 95.3
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 95.23
KOG1826|consensus 2724 95.22
KOG0034|consensus187 95.05
KOG0027|consensus151 95.0
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
Probab=100.00  E-value=3.8e-85  Score=704.76  Aligned_cols=287  Identities=29%  Similarity=0.475  Sum_probs=273.8

Q ss_pred             hhhhhhhhhhhccchhhHHHHHHhhhccCCcccccCCceeeeCCCCCCCCCCchhhhhccCCCCCCCChhhHHHHHHHHH
Q psy9090         190 TMHVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQ  269 (488)
Q Consensus       190 ~~~v~dl~~l~~l~e~~l~~~L~~r~~~~~~yt~v~~il~~Inp~~~~~i~~~ef~~~~~~~~~~~~~ph~f~~~d~~~~  269 (488)
                      ...++|+..|..+++++|+++|++||....||||.|-++++|||+.+++||..+.+..|.++.+.+.+||+|+||+.+|+
T Consensus        65 ~~~vdDLt~LSyLNEpsVl~nL~kRY~n~~IYTYSGlvLIAvNPy~~L~iYt~d~i~~Y~~K~r~el~PHvfAIAe~aY~  144 (1463)
T COG5022          65 FDGVDDLTELSYLNEPAVLHNLEKRYNNGQIYTYSGLVLIAVNPYRDLGIYTDDIIQSYSGKNRLELEPHVFAIAEEAYR  144 (1463)
T ss_pred             ccCchhhhhhhccCcHHHHHHHHHHhhcCceeEEeeeEEEEecCcccCCCccHHHHHHhccCccccCCchHHHHHHHHHH
Confidence            45789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCcEEEEcccccCCchhhHHHHHHHHHHhcCCCc----hhhhHhhhcchhhhhhhccccCCCCCCCccceeEEE
Q psy9090         270 DMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAA----KVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQV  345 (488)
Q Consensus       270 ~~~~~~~~q~i~~sgesgagkte~~k~i~~~~~~~~~g~~----~~~e~i~~~~~~leafgna~t~~n~nssrfgk~~~~  345 (488)
                      .|.+.+++|+|||||||||||||++|.||+|++..+++..    +++++|++.||||||||||||+|||||||||||++|
T Consensus       145 ~lls~~eNQtIiISGESGAGKTe~aK~ImqYlasv~~s~~~~~~~iE~~ILaTNPILEAFGNAkTvRNdNSSRFGKyikI  224 (1463)
T COG5022         145 NLLSEKENQTIIISGESGAGKTENAKRIMQYLASVTSSSTVEISSIEKQILATNPILEAFGNAKTVRNDNSSRFGKYIKI  224 (1463)
T ss_pred             HHHhcCCCceEEEecCCCCCchHHHHHHHHHHHHhccCCcchHHHHHHHHHhcchHHHHhccccccccCCcccccceEEE
Confidence            9999999999999999999999999999999999987755    899999999999999999999999999999999999


Q ss_pred             EECCCCceeceEEeeeecccceecccCCCCCcchHHHHHHHhhcchhhhhhhccCCCCCCCcccccCccCCCCCCCCCCC
Q psy9090         346 TFGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADVTDDKLPKGPRET  425 (488)
Q Consensus       346 ~~~~~~~~~~~~~~~yllek~rv~~~~~~~ernfHiFY~l~~g~~~~~~~~~~~l~~~~~~~yl~~~~~~~~~~~~~~~~  425 (488)
                      .||..|.|+||+|++|||||||||+ |..+|||||||||||+| +++..++.+++..|.+|.||+++.+       ...+
T Consensus       225 ~Fd~~g~I~GA~I~~YLLEKSRVV~-Q~~~ERNYHIFYQll~G-~~~~~k~~~~~~~~~dY~Yl~~~~~-------~~I~  295 (1463)
T COG5022         225 EFDENGEICGAKIETYLLEKSRVVH-QNKNERNYHIFYQLLAG-DPEELKKLLLLQNPKDYIYLSQGGC-------DKID  295 (1463)
T ss_pred             EECCCCceechhhhhhhhhhhhhcc-CCCCccchhhhhhHhcC-ChHHHHHHhhccChHhhHhHhhcCC-------CcCC
Confidence            9999999999999999999999995 99999999999999999 4556777788899999999998743       4578


Q ss_pred             CCccHHHHHHHHHHhhhcCCCHHHHHHHHHHHHHHHHhcCceEeecCCcccccCChhhhc
Q psy9090         426 PDTNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVAA  485 (488)
Q Consensus       426 ~~~d~~~~~~~~~a~~~lgf~~~~~~~i~~ilaaiLhlGni~F~~~~~~~~~~~~~~~~~  485 (488)
                      ++||+++|+.|+.||++|||+++++..||+|||||||||||+|.++.+|++.+.++++++
T Consensus       296 gIdD~kefk~t~~AlktiGi~~eeq~~IF~iLAaILhiGNIef~~~r~g~a~~~~~~~~~  355 (1463)
T COG5022         296 GIDDAKEFKITLDALKTIGIDEEEQDQIFKILAAILHIGNIEFKEDRNGAAIFSDNSVLD  355 (1463)
T ss_pred             CcccHHHHHHHHHHHHHhCCChHHHHHHHHHHHHHHhhcceeeeecccchhhcCCchHHH
Confidence            999999999999999999999999999999999999999999999889999999988776



>KOG0164|consensus Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>KOG3741|consensus Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG1826|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 2e-47
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-43
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 2e-42
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 3e-42
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 3e-42
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 5e-42
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 2e-41
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 2e-41
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 9e-41
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-40
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 3e-40
3a7f_A303 Human Mst3 Kinase Length = 303 6e-40
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 6e-40
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 6e-40
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 2e-35
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 3e-35
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 4e-33
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 7e-33
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 1e-32
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 1e-32
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 2e-32
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 4e-32
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 3e-31
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 4e-31
1lkx_A 697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 2e-30
4a7f_C 697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 2e-30
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 3e-28
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 3e-28
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 3e-28
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 3e-28
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 4e-28
4fie_A423 Full-Length Human Pak4 Length = 423 5e-28
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 4e-27
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 4e-26
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 6e-26
1oe9_A 795 Crystal Structure Of Myosin V Motor With Essential 2e-25
1w8j_A 766 Crystal Structure Of Myosin V Motor Domain - Nucleo 2e-25
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 3e-25
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 3e-24
1b7t_A 835 Myosin Digested By Papain Length = 835 3e-24
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 3e-24
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 3e-24
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 3e-24
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 3e-24
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 4e-24
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 5e-24
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 5e-24
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 5e-24
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 5e-24
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 5e-24
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 5e-24
2y0r_X 758 Structural Basis For The Allosteric Interference Of 5e-24
2y9e_X 758 Structural Basis For The Allosteric Interference Of 5e-24
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 5e-24
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 5e-24
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 6e-24
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 6e-24
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 6e-24
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 9e-24
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 1e-23
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-23
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 1e-23
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 1e-23
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-23
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 2e-23
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 2e-23
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 2e-23
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-23
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 3e-23
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 3e-23
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 3e-23
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 3e-23
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 3e-23
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 4e-23
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 4e-23
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 5e-23
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 5e-23
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 6e-23
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 9e-23
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 2e-22
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 2e-22
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 2e-22
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 3e-22
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 5e-22
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 8e-22
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 8e-22
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 8e-22
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 2e-21
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 2e-21
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 3e-21
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 3e-21
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 3e-21
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 3e-21
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 3e-21
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 4e-21
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 5e-21
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 1e-20
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 3e-20
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 3e-20
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 3e-20
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 4e-20
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 4e-20
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 4e-20
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 4e-20
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 4e-20
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 5e-20
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 5e-20
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 5e-20
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 5e-20
2x51_A 789 M6 Delta Insert1 Length = 789 5e-20
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 5e-20
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 5e-20
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 5e-20
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 5e-20
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 6e-20
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 6e-20
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 8e-20
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 8e-20
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 8e-20
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 9e-20
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 9e-20
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 1e-19
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 1e-19
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 1e-19
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 1e-19
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 1e-19
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-19
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 1e-19
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 2e-19
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 2e-19
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 2e-19
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-19
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 2e-19
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 2e-19
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-19
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 3e-19
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 3e-19
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 3e-19
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 3e-19
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 3e-19
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 3e-19
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 3e-19
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 3e-19
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 4e-19
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 4e-19
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 5e-19
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 5e-19
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 5e-19
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 5e-19
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 6e-19
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 7e-19
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 7e-19
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 7e-19
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-19
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 8e-19
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 1e-18
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 1e-18
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 1e-18
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 2e-18
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 2e-18
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 2e-18
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-18
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 3e-18
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 3e-18
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 3e-18
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-18
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-18
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 5e-18
3gni_B389 Structure Of Strad And Mo25 Length = 389 9e-18
2wtk_B373 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 1e-17
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 1e-17
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-17
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 1e-17
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 2e-17
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 2e-17
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 2e-17
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 2e-17
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 3e-17
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 3e-17
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 3e-17
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 3e-17
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 4e-17
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 4e-17
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 6e-17
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 7e-17
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 7e-17
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 8e-17
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 8e-17
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 8e-17
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 2e-16
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-16
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-16
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 2e-16
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 2e-16
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-16
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-16
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 2e-16
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 2e-16
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 2e-16
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 2e-16
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 2e-16
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 3e-16
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 3e-16
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 3e-16
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-16
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 4e-16
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 5e-16
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 6e-16
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 6e-16
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 7e-16
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 7e-16
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 9e-16
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 9e-16
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 1e-15
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 1e-15
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 1e-15
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 1e-15
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 1e-15
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 1e-15
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 1e-15
4h58_A275 Braf In Complex With Compound 3 Length = 275 1e-15
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-15
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-15
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 1e-15
3soa_A444 Full-Length Human Camkii Length = 444 1e-15
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 1e-15
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 1e-15
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-15
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-15
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 2e-15
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-15
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 2e-15
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 2e-15
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 2e-15
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 2e-15
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 2e-15
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-15
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-15
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 3e-15
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-15
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 3e-15
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 3e-15
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 3e-15
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 3e-15
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 3e-15
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 4e-15
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 4e-15
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 5e-15
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 5e-15
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 5e-15
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 5e-15
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 5e-15
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 6e-15
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 6e-15
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 7e-15
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 7e-15
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 8e-15
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 1e-14
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-14
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 1e-14
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 1e-14
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 1e-14
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 1e-14
3g51_A325 Structural Diversity Of The Active Conformation Of 1e-14
2oza_B366 Structure Of P38alpha Complex Length = 366 1e-14
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 1e-14
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-14
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 1e-14
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 1e-14
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 1e-14
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 1e-14
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 1e-14
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 1e-14
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 2e-14
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 2e-14
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 2e-14
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 2e-14
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 2e-14
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 2e-14
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 2e-14
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 2e-14
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 2e-14
3pg1_A362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 2e-14
3uib_A362 Map Kinase Lmampk10 From Leishmania Major In Comple 2e-14
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 2e-14
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 2e-14
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 3e-14
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-14
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 3e-14
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 3e-14
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-14
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-14
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 3e-14
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 3e-14
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 3e-14
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 3e-14
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 4e-14
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 4e-14
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 4e-14
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 4e-14
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 4e-14
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 4e-14
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 4e-14
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 4e-14
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 4e-14
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 4e-14
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 4e-14
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 4e-14
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 4e-14
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 4e-14
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 4e-14
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 4e-14
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 4e-14
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 4e-14
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 4e-14
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 4e-14
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 4e-14
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 4e-14
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 4e-14
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 4e-14
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 4e-14
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 4e-14
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 4e-14
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 4e-14
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 4e-14
3kk8_A284 Camkii Substrate Complex A Length = 284 5e-14
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 5e-14
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 5e-14
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 5e-14
3hec_A348 P38 In Complex With Imatinib Length = 348 5e-14
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 5e-14
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 5e-14
3kk9_A282 Camkii Substrate Complex B Length = 282 5e-14
1smh_A350 Protein Kinase A Variant Complex With Completely Or 5e-14
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 5e-14
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 5e-14
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 5e-14
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 5e-14
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 5e-14
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 6e-14
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 6e-14
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 6e-14
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 6e-14
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 6e-14
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 6e-14
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 7e-14
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 7e-14
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 7e-14
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 7e-14
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 7e-14
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 7e-14
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 7e-14
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 7e-14
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 7e-14
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 7e-14
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 7e-14
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 7e-14
4ae6_A343 Structure And Function Of The Human Sperm-specific 7e-14
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 7e-14
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 7e-14
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 7e-14
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 8e-14
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 8e-14
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 8e-14
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 8e-14
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 8e-14
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 8e-14
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 8e-14
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 8e-14
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 8e-14
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 8e-14
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 8e-14
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 8e-14
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 8e-14
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 8e-14
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 9e-14
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 9e-14
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 9e-14
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 9e-14
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 1e-13
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 1e-13
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 1e-13
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 1e-13
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 1e-13
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 1e-13
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-13
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 1e-13
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 1e-13
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 1e-13
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-13
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 1e-13
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 1e-13
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 1e-13
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-13
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 2e-13
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 2e-13
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 2e-13
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 2e-13
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 2e-13
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 2e-13
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 2e-13
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-13
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 2e-13
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 2e-13
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 2e-13
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 2e-13
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 2e-13
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 2e-13
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 3e-13
2oza_A356 Structure Of P38alpha Complex Length = 356 3e-13
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 3e-13
2qcs_A350 A Complex Structure Between The Catalytic And Regul 3e-13
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 3e-13
4ae9_A343 Structure And Function Of The Human Sperm-specific 3e-13
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 3e-13
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 3e-13
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 3e-13
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 3e-13
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-13
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 3e-13
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 3e-13
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 3e-13
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 3e-13
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 3e-13
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 3e-13
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 3e-13
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 3e-13
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 3e-13
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 3e-13
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 3e-13
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 3e-13
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 3e-13
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 3e-13
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 3e-13
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 3e-13
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 4e-13
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 4e-13
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 4e-13
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 4e-13
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 4e-13
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 4e-13
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 4e-13
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 4e-13
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 4e-13
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 5e-13
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 5e-13
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 5e-13
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 5e-13
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 5e-13
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 5e-13
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 5e-13
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 5e-13
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 6e-13
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 6e-13
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 6e-13
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 6e-13
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 7e-13
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 7e-13
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 8e-13
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 8e-13
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 8e-13
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 9e-13
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 9e-13
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 1e-12
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 1e-12
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 1e-12
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-12
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 2e-12
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 2e-12
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 2e-12
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-12
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-12
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 2e-12
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 2e-12
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-12
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 2e-12
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 2e-12
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-12
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 2e-12
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 3e-12
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 3e-12
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 3e-12
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 3e-12
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 3e-12
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 4e-12
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 4e-12
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 4e-12
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 4e-12
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 4e-12
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 4e-12
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 4e-12
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 4e-12
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 4e-12
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 4e-12
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 4e-12
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 4e-12
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 4e-12
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 4e-12
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 4e-12
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 4e-12
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 4e-12
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 4e-12
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 4e-12
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 4e-12
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 4e-12
2pl0_A289 Lck Bound To Imatinib Length = 289 5e-12
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 5e-12
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-12
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-12
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 5e-12
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 5e-12
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 5e-12
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 5e-12
3f5u_A295 Crystal Structure Of The Death Associated Protein K 5e-12
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 5e-12
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 5e-12
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-12
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 6e-12
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 7e-12
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 7e-12
3bhy_A283 Crystal Structure Of Human Death Associated Protein 8e-12
3b2t_A311 Structure Of Phosphotransferase Length = 311 8e-12
3cik_A689 Human Grk2 In Complex With Gbetagamma Subunits Leng 8e-12
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 8e-12
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 8e-12
1omw_A689 Crystal Structure Of The Complex Between G Protein- 8e-12
3psc_A695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 8e-12
3krw_A688 Human Grk2 In Complex With Gbetgamma Subunits And B 8e-12
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-12
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-12
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 8e-12
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-12
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-12
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 9e-12
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-12
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-11
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 1e-11
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 1e-11
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 1e-11
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 1e-11
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-11
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 1e-11
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 1e-11
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 1e-11
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 1e-11
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-11
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 1e-11
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 2e-11
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-11
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 2e-11
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 2e-11
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-11
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 2e-11
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 2e-11
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 2e-11
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 2e-11
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 2e-11
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 2e-11
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 2e-11
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 3e-11
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 3e-11
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 3e-11
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-11
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 3e-11
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 3e-11
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 3e-11
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 3e-11
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 3e-11
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 3e-11
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 3e-11
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 3e-11
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 3e-11
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 3e-11
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 3e-11
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 3e-11
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 3e-11
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 3e-11
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-11
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 3e-11
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 4e-11
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 4e-11
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-11
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 4e-11
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-11
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 4e-11
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 4e-11
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 4e-11
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 4e-11
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 5e-11
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 5e-11
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 5e-11
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 5e-11
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 5e-11
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 5e-11
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 5e-11
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 5e-11
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 6e-11
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 6e-11
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 6e-11
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 6e-11
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-11
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 6e-11
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 6e-11
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 6e-11
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-11
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 6e-11
4exu_A371 Mapk13, Inactive Form Length = 371 6e-11
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 6e-11
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 8e-11
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 8e-11
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 9e-11
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 9e-11
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 9e-11
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 9e-11
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 1e-10
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 1e-10
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 1e-10
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 1e-10
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-10
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 1e-10
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 1e-10
3a4o_X286 Lyn Kinase Domain Length = 286 1e-10
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 1e-10
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 1e-10
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 1e-10
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 1e-10
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 1e-10
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 2e-10
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 2e-10
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 2e-10
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-10
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 2e-10
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 2e-10
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 2e-10
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 2e-10
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 2e-10
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 2e-10
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 2e-10
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 2e-10
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 2e-10
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 2e-10
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-10
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 2e-10
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 2e-10
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 2e-10
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 3e-10
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 3e-10
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 3e-10
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 3e-10
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 3e-10
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 3e-10
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 3e-10
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 3e-10
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 3e-10
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 3e-10
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 3e-10
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 3e-10
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 3e-10
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 3e-10
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 3e-10
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 3e-10
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 3e-10
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 3e-10
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 3e-10
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 3e-10
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 3e-10
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 3e-10
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 3e-10
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 3e-10
4dym_A301 Crystal Structure Of The Acvr1 Kinase Domain In Com 3e-10
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 3e-10
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 3e-10
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 3e-10
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 3e-10
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 3e-10
3h9r_A330 Crystal Structure Of The Kinase Domain Of Type I Ac 3e-10
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 3e-10
3mtf_A301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 3e-10
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 4e-10
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 4e-10
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 4e-10
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 4e-10
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 4e-10
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 4e-10
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 4e-10
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 4e-10
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 4e-10
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 4e-10
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 4e-10
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 4e-10
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 4e-10
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 4e-10
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 4e-10
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 5e-10
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 5e-10
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 5e-10
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 6e-10
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 6e-10
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 7e-10
2nry_A307 Crystal Structure Of Irak-4 Length = 307 7e-10
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 7e-10
1fvr_A327 Tie2 Kinase Domain Length = 327 7e-10
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 7e-10
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 8e-10
2nru_A307 Crystal Structure Of Irak-4 Length = 307 8e-10
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 8e-10
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 9e-10
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 9e-10
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 9e-10
3lxn_A318 Structural And Thermodynamic Characterization Of Th 1e-09
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 1e-09
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 1e-09
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 1e-09
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 1e-09
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 1e-09
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 1e-09
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 1e-09
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 1e-09
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 1e-09
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 1e-09
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 1e-09
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 2e-09
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 2e-09
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 2e-09
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-09
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-09
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 2e-09
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 2e-09
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 2e-09
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 2e-09
2y4i_B319 Ksr2-Mek1 Heterodimer Length = 319 2e-09
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 2e-09
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 2e-09
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 2e-09
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 2e-09
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 2e-09
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 2e-09
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 2e-09
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 2e-09
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 2e-09
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 2e-09
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-09
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 2e-09
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 2e-09
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 2e-09
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 2e-09
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 2e-09
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 2e-09
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-09
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 2e-09
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 2e-09
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-09
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 2e-09
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 2e-09
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-09
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 2e-09
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 2e-09
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 2e-09
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 2e-09
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 2e-09
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-09
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-09
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 2e-09
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 2e-09
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 2e-09
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-09
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-09
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 2e-09
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 2e-09
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 2e-09
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 2e-09
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 2e-09
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-09
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-09
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 2e-09
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 2e-09
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 2e-09
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-09
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 2e-09
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 2e-09
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-09
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-09
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 3e-09
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 3e-09
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 3e-09
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 3e-09
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 3e-09
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 3e-09
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 3e-09
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 3e-09
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-09
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-09
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 3e-09
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 3e-09
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 3e-09
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 3e-09
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 3e-09
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 3e-09
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 3e-09
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 3e-09
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 3e-09
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-09
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 3e-09
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 3e-09
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 3e-09
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-09
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-09
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 3e-09
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 3e-09
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-09
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 4e-09
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 4e-09
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 4e-09
3rzf_A677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 4e-09
3qa8_A676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 4e-09
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 5e-09
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 5e-09
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 5e-09
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 5e-09
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 5e-09
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 5e-09
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 6e-09
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 6e-09
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 6e-09
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 6e-09
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 6e-09
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 6e-09
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 6e-09
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 7e-09
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 7e-09
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 7e-09
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 7e-09
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 7e-09
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 7e-09
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 7e-09
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 7e-09
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 7e-09
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 7e-09
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 7e-09
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 7e-09
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 7e-09
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 8e-09
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 8e-09
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 9e-09
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 9e-09
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 1e-08
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 1e-08
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 1e-08
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 1e-08
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 1e-08
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 1e-08
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 1e-08
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 1e-08
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 1e-08
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 1e-08
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 1e-08
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 1e-08
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 1e-08
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 1e-08
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 1e-08
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 1e-08
2g15_A318 Structural Characterization Of Autoinhibited C-Met 1e-08
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 1e-08
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-08
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 1e-08
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 2e-08
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 2e-08
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 2e-08
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-08
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-08
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-08
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 2e-08
1rjb_A344 Crystal Structure Of Flt3 Length = 344 2e-08
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 2e-08
4fl2_A636 Structural And Biophysical Characterization Of The 2e-08
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 2e-08
4fl3_A635 Structural And Biophysical Characterization Of The 3e-08
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 3e-08
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 3e-08
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 3e-08
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 3e-08
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 3e-08
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 4e-08
2rio_A434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 4e-08
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-08
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 4e-08
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 5e-08
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 5e-08
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 5e-08
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 5e-08
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 5e-08
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 5e-08
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 5e-08
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 5e-08
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 5e-08
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 5e-08
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 5e-08
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 5e-08
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 5e-08
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 5e-08
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 5e-08
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 5e-08
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 5e-08
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 6e-08
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 6e-08
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 6e-08
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 6e-08
3fbv_A448 Crystal Structure Of The Oligomer Formed By The Kin 6e-08
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 7e-08
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 7e-08
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 7e-08
3sdj_A448 Structure Of Rnase-Inactive Point Mutant Of Oligome 7e-08
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 7e-08
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 7e-08
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 7e-08
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 8e-08
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 8e-08
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 8e-08
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 9e-08
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 9e-08
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 1e-07
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 1e-07
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 1e-07
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 1e-07
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-07
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 1e-07
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 1e-07
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 1e-07
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 1e-07
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 1e-07
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 1e-07
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 1e-07
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 1e-07
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 1e-07
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 1e-07
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 1e-07
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 1e-07
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 1e-07
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 2e-07
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 2e-07
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 2e-07
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-07
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 2e-07
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 2e-07
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 2e-07
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 2e-07
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 2e-07
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 2e-07
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 2e-07
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 2e-07
4fst_A269 Crystal Structure Of The Chk1 Length = 269 2e-07
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 2e-07
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 2e-07
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 2e-07
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 2e-07
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 2e-07
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-07
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 3e-07
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 3e-07
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 3e-07
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 3e-07
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 3e-07
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 3e-07
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 3e-07
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 3e-07
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 3e-07
3lj0_A434 Ire1 Complexed With Adp And Quercetin Length = 434 3e-07
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 4e-07
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 4e-07
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 4e-07
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 4e-07
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 4e-07
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 5e-07
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 5e-07
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 5e-07
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 5e-07
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 5e-07
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 6e-07
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 6e-07
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 6e-07
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 6e-07
3lxk_A327 Structural And Thermodynamic Characterization Of Th 6e-07
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 7e-07
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 7e-07
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 7e-07
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 7e-07
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 7e-07
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 7e-07
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 8e-07
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 9e-07
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 9e-07
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 1e-06
3rgf_A405 Crystal Structure Of Human Cdk8CYCC Length = 405 1e-06
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 1e-06
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 1e-06
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 1e-06
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 1e-06
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 1e-06
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 1e-06
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 1e-06
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure

Iteration: 1

Score = 186 bits (472), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 87/185 (47%), Positives = 120/185 (64%), Gaps = 5/185 (2%) Query: 1 MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDK 60 + E+ IA+I +EI+ G+ LH++ VIHRD++G NVLLT++ EVK+VDFG+S + T + Sbjct: 126 LKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGR 185 Query: 61 KKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQ 120 + TF+G+P WMAPE++ C YD + D+W+LGITAIE+ +G PP DMHP RALF Sbjct: 186 RNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFL 245 Query: 121 IVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPENDLHLSTVN 180 I RNP P L ++ WS+ + FI CL KN RP +L++HPFI P V Sbjct: 246 IPRNPAPRL-KSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNE----RQVR 300 Query: 181 CQYKD 185 Q KD Sbjct: 301 IQLKD 305
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3GNI|B Chain B, Structure Of Strad And Mo25 Length = 389 Back     alignment and structure
>pdb|2WTK|B Chain B, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 373 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 4e-88
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 1e-81
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-77
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 4e-76
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 4e-74
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 5e-74
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 6e-73
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 2e-72
3aln_A327 Dual specificity mitogen-activated protein kinase; 8e-67
2dyl_A318 Dual specificity mitogen-activated protein kinase 1e-66
3fme_A290 Dual specificity mitogen-activated protein kinase; 1e-65
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-64
3an0_A340 Dual specificity mitogen-activated protein kinase; 3e-64
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 5e-62
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 4e-57
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 6e-54
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-53
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 4e-52
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 9e-52
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-51
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-51
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 2e-51
3eqc_A360 Dual specificity mitogen-activated protein kinase; 2e-50
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 2e-50
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 2e-50
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-50
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-49
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 6e-49
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 7e-49
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-48
2a19_B284 Interferon-induced, double-stranded RNA-activated 9e-47
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-46
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 2e-45
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 3e-44
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 8e-44
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-43
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-43
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 9e-42
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 5e-40
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-38
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 4e-38
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 6e-38
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 8e-38
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 2e-37
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-37
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 6e-37
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 1e-35
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 3e-35
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-35
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 4e-35
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-35
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-34
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-34
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 5e-34
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 6e-34
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-33
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 5e-33
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 6e-33
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-32
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-32
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 5e-32
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-31
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 1e-31
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-31
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 3e-31
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 3e-31
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 3e-31
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 4e-31
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 6e-31
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 8e-31
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-30
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-30
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-30
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 4e-30
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 5e-30
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-29
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 4e-29
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-29
3lij_A494 Calcium/calmodulin dependent protein kinase with A 5e-29
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 8e-29
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-29
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 9e-29
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 9e-29
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-28
3bhy_A283 Death-associated protein kinase 3; death associate 1e-28
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 1e-28
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-28
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-28
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-28
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 2e-28
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-28
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 3e-28
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-28
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 3e-28
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 3e-28
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 4e-28
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 4e-28
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 5e-28
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 5e-28
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 5e-28
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 8e-28
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 9e-28
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-27
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-27
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-27
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 1e-27
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-27
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 3e-27
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 3e-27
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 3e-27
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 4e-27
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 4e-27
3soc_A322 Activin receptor type-2A; structural genomics cons 7e-27
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 7e-27
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 8e-27
2y0a_A326 Death-associated protein kinase 1; transferase, ca 1e-26
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 2e-26
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 2e-26
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 2e-26
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 3e-26
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 3e-26
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 5e-26
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-25
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-25
3dls_A335 PAS domain-containing serine/threonine-protein KI; 1e-25
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 2e-25
2eue_A275 Carbon catabolite derepressing protein kinase; kin 3e-25
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 5e-25
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 5e-25
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 5e-25
3ork_A311 Serine/threonine protein kinase; structural genomi 1e-24
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-24
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-24
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-24
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-24
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-24
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 7e-24
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 1e-23
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 2e-23
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-23
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 3e-23
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 1e-22
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 1e-22
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-22
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 3e-22
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 4e-22
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 4e-22
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 4e-22
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 9e-22
2fst_X367 Mitogen-activated protein kinase 14; active mutant 1e-21
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 5e-21
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 8e-21
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 9e-21
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 9e-21
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-20
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-20
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-20
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-20
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 2e-20
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-20
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 4e-20
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 4e-20
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 4e-20
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-20
3niz_A311 Rhodanese family protein; structural genomics, str 8e-20
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 9e-20
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 1e-19
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-19
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-19
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 3e-19
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 4e-19
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 5e-19
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 8e-19
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-18
3o0g_A292 Cell division protein kinase 5; kinase activator c 1e-18
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 1e-18
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-18
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 1e-18
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-18
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-18
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 2e-18
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 3e-18
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 5e-18
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 6e-18
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 7e-18
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 7e-18
2xir_A316 Vascular endothelial growth factor receptor 2; ang 8e-18
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 9e-18
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 9e-18
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-17
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 1e-17
3rp9_A458 Mitogen-activated protein kinase; structural genom 1e-17
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 2e-17
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-17
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-17
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-17
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-17
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-17
3poz_A327 Epidermal growth factor receptor; kinase domain, a 4e-17
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 4e-17
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 5e-17
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 5e-17
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 6e-17
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 7e-17
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 8e-17
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-16
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-16
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 1e-16
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-16
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 1e-16
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-16
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-16
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 2e-16
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 2e-16
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 2e-16
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 3e-16
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 3e-16
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 3e-16
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-16
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 4e-16
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 4e-16
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 4e-16
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 4e-16
4aoj_A329 High affinity nerve growth factor receptor; transf 5e-16
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 8e-16
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 8e-16
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 1e-15
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 2e-15
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 3e-15
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-15
3uqc_A286 Probable conserved transmembrane protein; structur 4e-15
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-14
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-14
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-14
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-14
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-13
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 2e-12
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 2e-06
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 8e-06
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 9e-06
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 4e-04
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 4e-04
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 8e-04
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
 Score =  271 bits (696), Expect = 4e-88
 Identities = 83/172 (48%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 1   MSEQHIAFILKEIITGMVFLHENHVIHRDLRGSNVLLTKDGEVKIVDFGLSRETANTFDK 60
           + E+ IA+I +EI+ G+  LH++ VIHRD++G NVLLT++ EVK+VDFG+S +   T  +
Sbjct: 126 LKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGR 185

Query: 61  KKTFLGSPSWMAPEIMRCGHKEVDGYDNRIDVWALGITAIELGDGKPPFEDMHPTRALFQ 120
           + TF+G+P WMAPE++ C       YD + D+W+LGITAIE+ +G PP  DMHP RALF 
Sbjct: 186 RNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFL 245

Query: 121 IVRNPPPGLYRASNWSQHYVDFIAECLEKNPEHRPYMSELLEHPFITSLPEN 172
           I RNP P L ++  WS+ +  FI  CL KN   RP   +L++HPFI   P  
Sbjct: 246 IPRNPAPRL-KSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNE 296


>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 100.0
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 100.0
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 100.0
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 100.0
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 100.0
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 100.0
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 100.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 100.0
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 100.0
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 100.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.98
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.98
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.98
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.98
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.98
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.98
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.98
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.98
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.98
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.98
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.98
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.97
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.97
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.97
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.97
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.97
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.97
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.97
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.97
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.97
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.97
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.97
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.97
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.97
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.97
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.97
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.97
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.97
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.97
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.97
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.97
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.97
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.97
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.97
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.97
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.97
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.97
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.97
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.97
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.97
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.97
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.97
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.97
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.97
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.97
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.97
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.97
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.97
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.97
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.97
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.97
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.97
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.97
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.97
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.97
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.97
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.97
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.97
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.97
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.97
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.97
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.97
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.97
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.97
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.97
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.97
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.97
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.97
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.97
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.97
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.97
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.97
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.97
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.97
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.97
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.97
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.97
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.97
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.97
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.97
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.97
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.97
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.97
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.97
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.97
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.96
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.96
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.96
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.96
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.96
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.96
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.96
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.96
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.96
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.96
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.96
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.96
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.96
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.96
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.96
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.96
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.96
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.96
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.96
3bhy_A283 Death-associated protein kinase 3; death associate 99.96
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.96
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.96
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.96
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.96
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.96
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.96
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.96
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.96
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.96
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.96
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.96
3ork_A311 Serine/threonine protein kinase; structural genomi 99.96
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.96
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.96
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.96
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.95
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.95
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.95
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.95
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.95
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.95
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.95
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.95
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.95
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.95
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.95
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.95
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.95
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.95
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.95
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.95
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.95
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.95
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.95
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.95
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.95
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.95
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.95
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.95
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.95
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.95
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.95
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.95
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.95
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.95
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.95
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.95
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.95
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.95
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.95
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.95
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.95
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.95
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.95
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.95
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.95
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.95
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.95
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.95
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.94
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.94
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.94
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.94
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.94
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.94
3soc_A322 Activin receptor type-2A; structural genomics cons 99.94
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.94
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.94
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.94
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.94
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.94
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.94
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.94
3q4u_A301 Activin receptor type-1; structural genomics conso 99.94
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.94
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.94
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.94
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.94
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.94
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.94
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.94
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.94
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.94
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.94
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.94
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.94
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.94
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.94
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.94
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.94
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.93
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.93
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.93
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.93
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.93
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.93
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.93
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.93
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.93
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.93
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.93
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.92
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.92
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.9
3uqc_A286 Probable conserved transmembrane protein; structur 99.85
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.79
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.46
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.12
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.89
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.43
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.21
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 97.88
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 97.83
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 97.74
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 97.72
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 97.64
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 97.62
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 97.6
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 97.58
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 97.57
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.4
2lv7_A100 Calcium-binding protein 7; metal binding protein; 97.39
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 97.31
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.22
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 97.2
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 97.2
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 97.19
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 97.16
1exr_A148 Calmodulin; high resolution, disorder, metal trans 97.16
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 97.14
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 97.12
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 97.11
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 97.1
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 97.1
2jnf_A158 Troponin C; stretch activated muscle contraction, 97.1
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 97.08
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 97.07
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 97.05
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 97.02
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 97.02
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.02
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 96.99
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 96.97
3fwb_A161 Cell division control protein 31; gene gating, com 96.95
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 96.94
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 96.94
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 96.91
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 96.91
1y1x_A191 Leishmania major homolog of programmed cell death 96.91
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 96.9
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 96.89
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 96.86
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 96.85
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 96.85
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 96.84
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 96.82
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 96.81
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 96.8
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 96.79
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 96.79
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 96.78
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 96.78
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 96.77
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 96.76
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 96.74
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 96.72
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 96.7
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 96.7
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 96.69
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 96.69
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 96.69
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 96.69
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 96.67
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 96.67
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 96.65
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 96.64
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 96.63
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 96.62
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 96.62
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 96.62
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 96.61
1qjt_A99 EH1, epidermal growth factor receptor substrate su 96.59
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 96.59
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 96.58
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 96.56
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 96.5
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 96.5
1c07_A95 Protein (epidermal growth factor receptor pathway 96.47
3a4u_B143 Multiple coagulation factor deficiency protein 2; 96.46
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 96.44
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 96.43
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 96.38
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 96.36
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 96.35
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 96.34
3akb_A166 Putative calcium binding protein; EF-hand, metal b 96.33
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 96.31
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 96.31
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 96.26
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 96.25
3r70_A320 Aminoglycoside phosphotransferase; structural geno 96.24
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 96.23
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 96.23
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 96.21
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 96.16
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 96.14
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 96.1
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 96.09
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 96.07
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 96.07
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 96.06
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 96.05
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 96.03
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 96.02
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 96.02
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 96.0
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.99
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 95.97
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 95.96
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 95.95
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 95.95
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 95.87
1avs_A90 Troponin C; muscle contraction, calcium-activated, 95.81
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 95.79
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 95.78
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 95.77
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 95.77
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 95.77
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 95.76
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 95.75
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 95.75
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 95.75
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 95.71
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 95.68
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 95.67
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 95.63
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 95.62
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 95.59
2jq6_A139 EH domain-containing protein 1; metal binding prot 95.56
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 95.55
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 95.54
3li6_A66 Calcium-binding protein; calcium signaling protein 95.5
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 95.48
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.34
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 95.24
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 95.24
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 95.21
2q83_A346 YTAA protein; 2635576, structural genomics, joint 95.2
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 95.13
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 94.95
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 94.92
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 94.88
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 94.72
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 94.51
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 94.38
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 94.22
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 93.97
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 93.89
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 93.78
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 93.77
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 93.64
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 93.56
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 93.51
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 93.45
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 93.17
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 93.04
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 93.02
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 92.91
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 92.91
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 92.79
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 92.4
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 92.11
3a4u_B143 Multiple coagulation factor deficiency protein 2; 91.95
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 91.92
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 91.14
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 90.7
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 90.57
1exr_A148 Calmodulin; high resolution, disorder, metal trans 90.48
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 90.48
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 90.39
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 90.25
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 90.1
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 89.85
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 89.8
2hps_A186 Coelenterazine-binding protein with bound coelent; 89.8
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 89.73
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 89.71
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 89.68
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 89.65
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 89.55
3fwb_A161 Cell division control protein 31; gene gating, com 89.47
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 89.42
1y1x_A191 Leishmania major homolog of programmed cell death 89.25
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 89.14
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 89.11
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 88.84
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 88.62
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 88.59
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 88.48
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 88.41
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 88.28
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 88.21
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 88.18
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 88.15
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 87.73
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 87.43
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 87.06
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 86.94
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 86.88
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 86.75
3ats_A357 Putative uncharacterized protein; hypothetical pro 86.69
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 86.64
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 86.46
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 86.41
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 86.37
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 86.34
3bos_A242 Putative DNA replication factor; P-loop containing 86.12
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 86.09
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 86.05
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 85.81
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 85.81
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 85.72
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 85.71
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 85.47
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 85.39
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 85.14
2jnf_A158 Troponin C; stretch activated muscle contraction, 85.1
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 84.48
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 84.2
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 83.95
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 83.94
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 83.64
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 83.54
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 83.3
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 83.22
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 82.87
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 82.78
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 82.68
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 82.65
2eyu_A261 Twitching motility protein PILT; pilus retraction 82.55
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 82.39
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 82.25
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 82.1
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 81.06
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
Probab=100.00  E-value=2.8e-82  Score=676.54  Aligned_cols=285  Identities=29%  Similarity=0.500  Sum_probs=266.0

Q ss_pred             hhhhhhhhhccchhhHHHHHHhhhccCCcccccCCceeeeCCCCCCCCCCchhhhhccCCCCCCCChhhHHHHHHHHHHH
Q psy9090         192 HVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDM  271 (488)
Q Consensus       192 ~v~dl~~l~~l~e~~l~~~L~~r~~~~~~yt~v~~il~~Inp~~~~~i~~~ef~~~~~~~~~~~~~ph~f~~~d~~~~~~  271 (488)
                      .++|+..+..++++.++++|+.||..+.+|||+|+++++|||++.+++|.++.+..|.++...+.|||+|+|||+||+.|
T Consensus         9 ~~~Dl~~L~~l~E~~vl~nL~~Ry~~~~IYTy~G~iLiavNPyk~l~iY~~~~~~~Y~g~~~~~~pPHifaiA~~Ay~~m   88 (697)
T 1lkx_A            9 GVPDFVLLNQITENAFIENLTMRHKSDNIYTYIGDVVISTNPFKNLNIYKESDIKAYNGRYKYEMPPHMYALANDAYRSM   88 (697)
T ss_dssp             CCSSGGGCSSCSHHHHHHHHHHHHHTTCCEEESSSCEEEECCSSCCSCCSHHHHHHHSSCCGGGSCCCHHHHHHHHHHHH
T ss_pred             CCcccccCCCCCHHHHHHHHHHHHhcCCcEEeeCCeEEEEcCCcCCCCCCHHHHHHHhCCCCCCCCchHHHHHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCcEEEEcccccCCchhhHHHHHHHHHHhcC-CC---chhhhHhhhcchhhhhhhccccCCCCCCCccceeEEEEE
Q psy9090         272 MHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQ-GA---AKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVTF  347 (488)
Q Consensus       272 ~~~~~~q~i~~sgesgagkte~~k~i~~~~~~~~~-g~---~~~~e~i~~~~~~leafgna~t~~n~nssrfgk~~~~~~  347 (488)
                      ...+++|||||||||||||||++|.||+|++..+. +.   ..++++|+++||+|||||||||+||||||||||||+|+|
T Consensus        89 ~~~~~nQsIiisGESGAGKTe~tK~i~~yla~~~~~~~~~~~~i~~~il~snpiLEAFGNAkT~rNdNSSRFGKfi~i~F  168 (697)
T 1lkx_A           89 RQSQENQCVIISGESGAGKTEASKKIMQFLTFVSSNQSPNGERISKMLLDSNPLLEAFGNAKTLRNDNSSRFGKYMEMQF  168 (697)
T ss_dssp             HHHCCCEEEEEECSTTSSHHHHHHHHHHHHHHHSCSSCHHHHHHHHHHHHHHHHHHHHHBBCCSSCSSCBCSEEEEEEEE
T ss_pred             HhcCCCcEEEecCCCCCCchhhHHHHHHHHHhhcCCCCCccccHHHHHHhcchHHHHhcCcccCCCCCcchhheeEEEEE
Confidence            99999999999999999999999999999999986 32   368899999999999999999999999999999999999


Q ss_pred             CCCCceeceEEeeeecccceecccCCCCCcchHHHHHHHhhcchhhhhhhccCC-CCCCCcccccCccCCCCCCCCCCCC
Q psy9090         348 GSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLS-PGRKYRYLRADVTDDKLPKGPRETP  426 (488)
Q Consensus       348 ~~~~~~~~~~~~~yllek~rv~~~~~~~ernfHiFY~l~~g~~~~~~~~~~~l~-~~~~~~yl~~~~~~~~~~~~~~~~~  426 (488)
                      +..|.|+||+|++|||||||||. |.+||||||||||||+|+++ ++++.++|. ++..|+||+++.+       ...++
T Consensus       169 ~~~g~i~Ga~I~~yLLEKSRVv~-q~~gERnfHIFYqllaG~~~-~~~~~l~L~~~~~~y~yL~~~~~-------~~~~~  239 (697)
T 1lkx_A          169 NAVGSPIGGKITNYLLEKSRVVG-RTQGERSFHIFYQMLKGLSQ-SKLDELGLTPNAPAYEYLKKSGC-------FDVST  239 (697)
T ss_dssp             CTTCCEEEEEEEEECCCGGGGTC-CCTTCCCBHHHHHHHTTSCH-HHHHHHTCCSCGGGSHHHHHTTC-------CCCTT
T ss_pred             CCCCCEeeeeeeeeeccCceeee-ecCCCCceeehhHHhcCCCH-HHHHHhcCCCChhhCccccCCCC-------cccCC
Confidence            99999999999999999999995 99999999999999999976 567888897 8999999988743       34578


Q ss_pred             CccHHHHHHHHHHhhhcCCCHHHHHHHHHHHHHHHHhcCceEee-----cCCcccccCChhhhc
Q psy9090         427 DTNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFES-----SAENTAELANPEVAA  485 (488)
Q Consensus       427 ~~d~~~~~~~~~a~~~lgf~~~~~~~i~~ilaaiLhlGni~F~~-----~~~~~~~~~~~~~~~  485 (488)
                      .||+++|+++++||++|||+++|+..||+|||||||||||+|++     .+++.+++.+++.++
T Consensus       240 ~dD~~~f~~~~~Am~~lG~~~~e~~~i~~ilaaILhLGNi~F~~~~~~~~~~~~~~v~~~~~l~  303 (697)
T 1lkx_A          240 IDDSGEFKIIVKAMETLGLKESDQNSIWRILAAILHIGNITFAEAAEQRTGTTTVKVSDTKSLA  303 (697)
T ss_dssp             CCHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCEEEETTC----CEEEESSHHHHH
T ss_pred             CchHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHhcccceEeecccccCCCCcceeCCHHHHH
Confidence            89999999999999999999999999999999999999999987     333678888887665



>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 488
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 3e-65
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 7e-63
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 1e-61
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 3e-61
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 4e-59
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 4e-59
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-54
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-48
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 6e-48
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-47
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 6e-45
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 9e-45
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 6e-44
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-42
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-42
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 6e-41
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-39
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-39
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 8e-39
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 6e-38
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-37
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-36
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-36
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-36
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 8e-36
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 9e-36
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-35
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-35
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-34
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-34
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-34
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-34
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 4e-34
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-34
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-34
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-33
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-33
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-33
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-33
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 4e-33
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 5e-33
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 8e-33
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 9e-33
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-32
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-32
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-32
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-32
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-32
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 9e-32
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-31
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 8e-31
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 9e-31
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-30
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-30
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 4e-30
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 8e-30
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-29
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-28
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 4e-28
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 6e-28
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-27
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-27
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 5e-27
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 5e-27
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-25
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-24
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-24
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-17
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-09
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]
 Score =  221 bits (563), Expect = 3e-65
 Identities = 88/298 (29%), Positives = 146/298 (48%), Gaps = 16/298 (5%)

Query: 193 VEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKS 252
           V D   L  I+E+  ++ L  RH S N Y+++GDV++  NP  +LN+Y       Y  + 
Sbjct: 2   VPDFVLLNQITENAFIENLTMRHKSDNIYTYIGDVVISTNPFKNLNIYKESDIKAYNGRY 61

Query: 253 RSDNEPHIYAVADSAYQDMMHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQGAAKVG 312
           + +  PH+YA+A+ AY+ M   +E Q ++++GE+ AGKT + K +++ L F+    +  G
Sbjct: 62  KYEMPPHMYALANDAYRSMRQSQENQCVIISGESGAGKTEASKKIMQFLTFVSSNQSPNG 121

Query: 313 EKIEKCV----NVIHAIGNAGTPINQNSTRHVLYMQVTFGSSGKLSGAIFWLYQLEKWRV 368
           E+I K +     ++ A GNA T  N NS+R   YM++ F + G   G     Y LEK RV
Sbjct: 122 ERISKMLLDSNPLLEAFGNAKTLRNDNSSRFGKYMEMQFNAVGSPIGGKITNYLLEKSRV 181

Query: 369 TGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADVTDDKLPKGPRETPDT 428
            G     + +FHIFY     +  +   +         Y YL+          G  +    
Sbjct: 182 VGRTQG-ERSFHIFYQMLKGLSQSKLDELGLTPNAPAYEYLKKS--------GCFDVSTI 232

Query: 429 N-VAKFQEIYQNLIDIEF-DDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVA 484
           +   +F+ I + +  +   +  Q  I+  +LAAIL IG + F  +AE        +V+
Sbjct: 233 DDSGEFKIIVKAMETLGLKESDQNSIWR-ILAAILHIGNITFAEAAEQRTGTTTVKVS 289


>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 100.0
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 100.0
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 100.0
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.98
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.98
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.98
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.98
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.98
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.98
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.98
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.98
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.97
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.97
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.97
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.97
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.97
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.97
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.97
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.96
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.96
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.96
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.96
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.95
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.95
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.3
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.06
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 97.99
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.58
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 97.45
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.4
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 97.33
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 97.32
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 97.24
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 97.22
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 97.19
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.13
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.11
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 97.08
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.06
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 97.02
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.0
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 96.99
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 96.98
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.94
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 96.93
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 96.89
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 96.85
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.8
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 96.79
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 96.79
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 96.72
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 96.72
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 96.71
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 96.61
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 96.61
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 96.58
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 96.56
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 96.55
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.55
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 96.54
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.51
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 96.5
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.46
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 96.42
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 96.38
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 96.35
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 96.35
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 96.29
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 96.19
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 96.17
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 96.15
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 96.11
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 96.11
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 96.02
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 95.72
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 95.71
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 95.66
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 95.45
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 95.23
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 95.1
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 94.89
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 94.75
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 94.55
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 94.3
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 94.26
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 94.21
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 94.18
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 94.14
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 94.12
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 93.6
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 93.59
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 93.44
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 92.9
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 92.41
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 92.07
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 91.84
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 91.0
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 90.98
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 90.8
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 90.7
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 90.57
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 89.82
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 89.79
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 89.6
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 88.99
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 88.84
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 88.04
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 88.03
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.71
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 86.3
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 85.39
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 84.64
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 84.64
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 84.15
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 84.06
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 83.09
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 83.08
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 82.88
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 82.87
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 82.12
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 81.69
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 81.56
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 81.25
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 80.89
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 80.75
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 80.56
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 80.55
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 80.23
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 80.06
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]
Probab=100.00  E-value=4.5e-77  Score=640.66  Aligned_cols=285  Identities=27%  Similarity=0.433  Sum_probs=266.6

Q ss_pred             hhhhhhhhhccchhhHHHHHHhhhccCCcccccCCceeeeCCCCCCCCCCchhhhhccCCCCCCCChhhHHHHHHHHHHH
Q psy9090         192 HVEDLAALETISEDNIVQELEERHNSKNHYSFVGDVLLFINPNTHLNLYGTKYHFKYKFKSRSDNEPHIYAVADSAYQDM  271 (488)
Q Consensus       192 ~v~dl~~l~~l~e~~l~~~L~~r~~~~~~yt~v~~il~~Inp~~~~~i~~~ef~~~~~~~~~~~~~ph~f~~~d~~~~~~  271 (488)
                      .++|+..+..++|+.++.+|+.||..+.+|||+|+++++|||++.+++|.++++..|.++.....|||+|++|++||+.|
T Consensus        40 ~v~Dl~~L~~l~E~~vl~~L~~Ry~~~~iYT~~G~iLiavNP~k~l~iy~~~~~~~y~~~~~~~~~PHifaiA~~Ay~~m  119 (712)
T d1d0xa2          40 GVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSM  119 (712)
T ss_dssp             TCSBGGGCSSCCHHHHHHHHHHHHHTTCCEEEETTEEEEECCSSCCSCCSHHHHHHHTTCCGGGSCCCHHHHHHHHHHHH
T ss_pred             CCchhhcCCCCCHHHHHHHHHHHHcCCCceeeECCEEEEECCCCCCCCCCHHHHHHHcCCCcCCCCCcHHHHHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCcEEEEcccccCCchhhHHHHHHHHHHhcC-----CCchhhhHhhhcchhhhhhhccccCCCCCCCccceeEEEE
Q psy9090         272 MHHEEAQHIVLAGETLAGKTTSLKHLLKHLIFLGQ-----GAAKVGEKIEKCVNVIHAIGNAGTPINQNSTRHVLYMQVT  346 (488)
Q Consensus       272 ~~~~~~q~i~~sgesgagkte~~k~i~~~~~~~~~-----g~~~~~e~i~~~~~~leafgna~t~~n~nssrfgk~~~~~  346 (488)
                      ++.+++|+|||||||||||||++|.||+|++..+.     +...+++.|++++|+|||||||||+|||||||||||++|+
T Consensus       120 ~~~~~nQsIiisGeSGaGKTe~~k~il~yL~~~s~~~~~~~~~~i~~~i~~~n~iLEAFGNAkT~~N~NSSRFGk~~~l~  199 (712)
T d1d0xa2         120 LDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQ  199 (712)
T ss_dssp             HHHTCCEEEEEECSTTSSHHHHHHHHHHHHHHHHSCC-----CHHHHHHHHHHHHHHHHHEECCSSCTTEESSEEEEEEE
T ss_pred             HHhCCCceEEEeCCCCCCHHHHHHHHHHHHHHHhCCCcccccchHHHHHHhhhhHHHHhcCcCcCCCCCccceeEEEEEE
Confidence            99999999999999999999999999999998754     3456999999999999999999999999999999999999


Q ss_pred             ECCCCceeceEEeeeecccceecccCCCCCcchHHHHHHHhhcchhhhhhhccCCCCCCCcccccCccCCCCCCCCCCCC
Q psy9090         347 FGSSGKLSGAIFWLYQLEKWRVTGNRDPLQANFHIFYYFYDAMEAAGELDKYFLSPGRKYRYLRADVTDDKLPKGPRETP  426 (488)
Q Consensus       347 ~~~~~~~~~~~~~~yllek~rv~~~~~~~ernfHiFY~l~~g~~~~~~~~~~~l~~~~~~~yl~~~~~~~~~~~~~~~~~  426 (488)
                      |+..|.|+||+|.+|||||||||. |.+||||||||||||+|++. ++++.+.|.++..|+||+++.+       ...++
T Consensus       200 f~~~g~i~ga~i~~yLLEksRvv~-~~~gErnfHIFYqll~g~~~-~~~~~~~l~~~~~~~yL~~~~~-------~~~~~  270 (712)
T d1d0xa2         200 FNNAGFISGASIQSYLLEKSRVVF-QSETERNYHIFYQLLAGATA-EEKKALHLAGPESFNYLNQSGC-------VDIKG  270 (712)
T ss_dssp             ECTTSCEEEEEEEEECCCGGGGTC-CCTTCCSBHHHHHHHHHSCH-HHHHHHTCCCGGGCTTTSSSSC-------CCCTT
T ss_pred             EcCCCccccceeEEeccCCceEEe-eccccccHHHHHHHHhCCCH-HHHHHhCCCCchhcccccCCCC-------cccCC
Confidence            999999999999999999999995 99999999999999999987 5678889999999999987743       23567


Q ss_pred             CccHHHHHHHHHHhhhcCCCHHHHHHHHHHHHHHHHhcCceEeecCCcccccCChhhhc
Q psy9090         427 DTNVAKFQEIYQNLIDIEFDDIQMEIFSNVLAAILLIGEVEFESSAENTAELANPEVAA  485 (488)
Q Consensus       427 ~~d~~~~~~~~~a~~~lgf~~~~~~~i~~ilaaiLhlGni~F~~~~~~~~~~~~~~~~~  485 (488)
                      .+|+++|+++++||+.|||+++|+..||+|||||||||||+|.+.+.+.+.+.+++.++
T Consensus       271 ~dd~~~f~~~~~al~~lgfs~~e~~~i~~iLaaILhLGNi~F~~~~~~~~~i~~~~~l~  329 (712)
T d1d0xa2         271 VSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALN  329 (712)
T ss_dssp             CCHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHTCCCBCCSSSSCBCSCCHHHH
T ss_pred             cChHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhhccceEeecCCcceecCCHHHHH
Confidence            88999999999999999999999999999999999999999988777788888876654



>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure