Diaphorina citri psyllid: psy9091

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MSKTFHELAQEKRKREAEMPPPRALKPDELDLDNLQDCGDRYELGYVIGSGVCADVYEALDTQNGNKKVSIKVQKINPEFIDDIKEEYRMLRDLSQHSNIPDFFGAYMKKHQTHSEIWFVMQREAEMPPPRALKPDELDLDNLQDCGDRYELGYVIGSGVCADVYEALDTQNVTSI
ccHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEECcccccEEEEEEEcccccCEEEEEEcccccccHHHHHHHHHHHHHcccccccccccccEEEccccccEEEEEEEEccccccccccccccccccccccccccccccEEEcHHHHHHHHHHHcccccccc
********************************DNLQDCGDRYELGYVIGSGVCADVYEALDTQNGNKKVSIKVQKINPEFIDDIKEEYRMLRDLSQHSNIPDFFGAYMKKHQTHSEIWFVMQREAEMPPPRAL*PDEL*LDNLQDCGDRYELGYVIGSGVCADVYEALDTQN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKTFHELAQEKRKREAEMPPPRALKPDELDLDNLQDCGDRYELGYVIGSGVCADVYEALDTQNGNKKVSIKVQKINPEFIDDIKEEYRMLRDLSQHSNIPDFFGAYMKKHQTHSEIWFVMQREAEMPPPRALKPDELDLDNLQDCGDRYELGYVIGSGVCADVYEALDTQNVTSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X7F, chain A
Confidence level:very confident
Coverage over the Query: 32-174
View the alignment between query and template
View the model in PyMOL