Diaphorina citri psyllid: psy90

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----

MSGIAIGRLSEERKGWRKDHPFGFVAKPAKNPDGSLNLMNWECSIPGKKGTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY

ccHHHHHHHHHHHHHHHHcccccCEEEEcccccccccccEEEEEccccccccccccEEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHc

****AIGRLSEERKGWRKDHPFGFVAKPAKNPDGSLNLMNWECSIPGKKGTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSGIAIGRLSEERKGWRKDHPFGFVAKPAKNPDGSLNLMNWECSIPGKKGTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
SUMO-conjugating enzyme UBC9	Accepts the ubiquitin-like proteins sumo1, sumo2 and sumo3 from the uble1a-uble1b E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as ranbp2 or cbx4. Essential for nuclear architecture and chromosome segregation.	very confident	Q28CQ4
SUMO-conjugating enzyme UBC9-B	Accepts the ubiquitin-like proteins sumo1, sumo2 and sumo3 from the uble1a-uble1b E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as ranbp2 or cbx4. Essential for nuclear architecture and chromosome segregation (By similarity). Mediates nuclear localization of vsx1. Required for progression through mitosis during organogenesis.	very confident	Q9DDJ0
SUMO-conjugating enzyme UBC9	Accepts the ubiquitin-like protein smo-1 from the aos-1-uba-2 E1 complex and catalyzes its covalent attachment to other proteins with the help of an E3 ligase such as gei-17. Required to sumoylate the ETS transcription factor lin-1 and the Polycomb protein sop-2. Required for embryonic development, fertility, vulval morphogenesis and inhibition of vulval cell fates.	very confident	Q95017

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016605 [CC]	PML body	confident	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0004842 [MF]	ubiquitin-protein ligase activity	confident	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0008022 [MF]	protein C-terminus binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	confident	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0001650 [CC]	fibrillar center	confident	GO:0005575, GO:0043232, GO:0031981, GO:0005730, GO:0005634, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0031974, GO:0044452, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0033145 [BP]	positive regulation of intracellular steroid hormone receptor signaling pathway	confident	GO:0033143, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0016567 [BP]	protein ubiquitination	confident	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0000780 [CC]	condensed nuclear chromosome, centromeric region	confident	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000793, GO:0000794, GO:0000775, GO:0043231, GO:0043232, GO:0000779, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0045202 [CC]	synapse	confident	GO:0005575
GO:0051091 [BP]	positive regulation of sequence-specific DNA binding transcription factor activity	confident	GO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0019904 [MF]	protein domain specific binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0043161 [BP]	proteasomal ubiquitin-dependent protein catabolic process	confident	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0010469 [BP]	regulation of receptor activity	confident	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0065009, GO:0010646, GO:0050789
GO:0000940 [CC]	condensed chromosome outer kinetochore	confident	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0000793, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000779, GO:0043229, GO:0043228, GO:0044422, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0000776, GO:0000777
GO:0030425 [CC]	dendrite	confident	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0043425 [MF]	bHLH transcription factor binding	confident	GO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0019789 [MF]	SUMO ligase activity	confident	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0016925 [BP]	protein sumoylation	confident	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0070936 [BP]	protein K48-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0007088 [BP]	regulation of mitosis	probable	GO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0035172 [BP]	hemocyte proliferation	probable	GO:0002376, GO:0008150, GO:0044699, GO:0008283
GO:0032093 [MF]	SAM domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0007352 [BP]	zygotic specification of dorsal/ventral axis	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0009880, GO:0044707, GO:0009950, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0000578, GO:0009798, GO:0007275, GO:0044699
GO:0071535 [MF]	RING-like zinc finger domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0016321 [BP]	female meiosis chromosome segregation	probable	GO:0007126, GO:0048610, GO:0051321, GO:0000003, GO:0045132, GO:0044763, GO:0008150, GO:0022402, GO:0044699, GO:0007059, GO:0009987, GO:0007143, GO:0007049
GO:0009952 [BP]	anterior/posterior pattern specification	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0051301 [BP]	cell division	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0070534 [BP]	protein K63-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001085 [MF]	RNA polymerase II transcription factor binding	probable	GO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0061484 [BP]	hematopoietic stem cell homeostasis	probable	GO:0042592, GO:0008150, GO:0065008, GO:0065007, GO:0048872
GO:0032880 [BP]	regulation of protein localization	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0031072 [MF]	heat shock protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0045751 [BP]	negative regulation of Toll signaling pathway	probable	GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008592, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0035204 [BP]	negative regulation of lamellocyte differentiation	probable	GO:0051093, GO:0002682, GO:0035203, GO:0008150, GO:0050793, GO:0048580, GO:0050789, GO:0045596, GO:0045595, GO:0065007, GO:2000026, GO:0002683, GO:0051239, GO:0045614, GO:0048519, GO:0050794, GO:0045610, GO:0045611, GO:0048523, GO:0045613
GO:0035207 [BP]	negative regulation of hemocyte proliferation	probable	GO:0042127, GO:0008285, GO:0035206, GO:0050793, GO:0050794, GO:0008150, GO:0065007, GO:0002682, GO:0002683, GO:0051239, GO:0048519, GO:0050789, GO:0048523
GO:0040025 [BP]	vulval development	probable	GO:0032502, GO:0009791, GO:0048856, GO:0044707, GO:0048569, GO:0032501, GO:0002119, GO:0044767, GO:0048513, GO:0002164, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006959 [BP]	humoral immune response	probable	GO:0002376, GO:0050896, GO:0008150, GO:0006955
GO:0071560 [BP]	cellular response to transforming growth factor beta stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0071363, GO:0050896, GO:0009987, GO:0044763, GO:0070848, GO:0010033, GO:0071310, GO:0008150, GO:0070887, GO:0042221, GO:0071559, GO:0044699
GO:0007067 [BP]	mitosis	probable	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0007095 [BP]	mitotic G2 DNA damage checkpoint	probable	GO:0010948, GO:0044773, GO:1901991, GO:1901990, GO:0050789, GO:0044699, GO:0051716, GO:0031572, GO:0031570, GO:0010564, GO:0065007, GO:0007049, GO:0048519, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:0044774, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0044763, GO:0033554, GO:0022402, GO:0048523, GO:0007093
GO:0000795 [CC]	synaptonemal complex	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000793, GO:0000794, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0043282 [BP]	pharyngeal muscle development	probable	GO:0032502, GO:0055123, GO:0007517, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0060465, GO:0007275, GO:0044699
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0018991 [BP]	oviposition	probable	GO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0043398 [MF]	HLH domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0070979 [BP]	protein K11-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0040027 [BP]	negative regulation of vulval development	probable	GO:0051093, GO:0050793, GO:0051241, GO:0040028, GO:0048581, GO:0048580, GO:0050789, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0061062, GO:0061064
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0033503 [CC]	HULC complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0000792, GO:0043229, GO:0043228, GO:0000785, GO:0043226, GO:0044424, GO:0044427, GO:0005694, GO:0031371, GO:0044422
GO:0007391 [BP]	dorsal closure	probable	GO:0048598, GO:0002009, GO:0001700, GO:0048856, GO:0044707, GO:0032501, GO:0060429, GO:0016331, GO:0009888, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0043951 [BP]	negative regulation of cAMP-mediated signaling	probable	GO:0009968, GO:0043949, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0006301 [BP]	postreplication repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0033235 [BP]	positive regulation of protein sumoylation	probable	GO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0033233, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0007281 [BP]	germ cell development	probable	GO:0032502, GO:0044702, GO:0048609, GO:0032504, GO:0022414, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0019953, GO:0044767, GO:0003006, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0009987, GO:0000003, GO:0007276, GO:0048856
GO:0007283 [BP]	spermatogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0005657 [CC]	replication fork	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0009411 [BP]	response to UV	probable	GO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016322 [BP]	neuron remodeling	probable	GO:0032502, GO:0030154, GO:0048468, GO:0007569, GO:0010259, GO:0007275, GO:0044699, GO:0042551, GO:0048869, GO:0008150, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0044314 [BP]	protein K27-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0035519 [BP]	protein K29-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0031647 [BP]	regulation of protein stability	probable	GO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0019048 [BP]	virus-host interaction	probable	GO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0009737 [BP]	response to abscisic acid stimulus	probable	GO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0097305, GO:0010033
GO:0000086 [BP]	G2/M transition of mitotic cell cycle	probable	GO:0000278, GO:0008150, GO:0009987, GO:0044770, GO:0044772, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0007166 [BP]	cell surface receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0085020 [BP]	protein K6-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0061418 [BP]	regulation of transcription from RNA polymerase II promoter in response to hypoxia	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0001666, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0043618, GO:0019219, GO:0071453, GO:0010556, GO:0065007, GO:0071456, GO:0043620, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0044763, GO:0051171, GO:2001141, GO:0042221, GO:0070482, GO:0009628, GO:0036293, GO:0050896, GO:0051252, GO:0036294, GO:0006355, GO:0006357, GO:0033554, GO:0008150
GO:0006366 [BP]	transcription from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0006513 [BP]	protein monoubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0031398 [BP]	positive regulation of protein ubiquitination	probable	GO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0042787 [BP]	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0070647, GO:0032446, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0006511
GO:0043581 [BP]	mycelium development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0031056 [BP]	regulation of histone modification	probable	GO:0033044, GO:0032268, GO:0080090, GO:0019222, GO:0033043, GO:0060255, GO:0031323, GO:0051246, GO:0051128, GO:0065007, GO:0031399, GO:0008150, GO:0050794, GO:0050789
GO:0033522 [BP]	histone H2A ubiquitination	probable	GO:0044699, GO:0044267, GO:0044260, GO:0032446, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0016574, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0031625 [MF]	ubiquitin protein ligase binding	probable	GO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0000022 [BP]	mitotic spindle elongation	probable	GO:0006996, GO:0044699, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0000226, GO:0008150, GO:0007051, GO:0007052, GO:0022402, GO:0007049, GO:0044763, GO:0051231, GO:0016043
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0008054 [BP]	cyclin catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0051179 [BP]	localization	probable	GO:0008150
GO:0001741 [CC]	XY body	probable	GO:0043232, GO:0044464, GO:0000803, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0000502 [CC]	proteasome complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0051865 [BP]	protein autoubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0043130 [MF]	ubiquitin binding	probable	GO:0003674, GO:0032182, GO:0005488, GO:0005515
GO:0006342 [BP]	chromatin silencing	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0010994 [BP]	free ubiquitin chain polymerization	probable	GO:0051258, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0032844, GO:0065003, GO:0044085, GO:0065007, GO:0071840, GO:0034622, GO:0008150, GO:0050794, GO:0043623, GO:0050789, GO:0010993

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GRR, chain A
Confidence level:very confident
Coverage over the Query: 1-125
View the alignment between query and template
View the model in PyMOL