Diaphorina citri psyllid: psy9118

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---

MFDRGTITAKVLSSRNRREKEDRIGESQPFQERTLSVQDKIRSGRAMADSLLVGIVSLFSLLLVFNYSFHKIEEGHVGVYFRGGALLSTISGPGFHAMIPFITTFRHVQVTLQTDEVKNVPCGTSGGVMIYFDRIEVVNVLSVSSVYDIVKNYTADYDKALIFNKVHHELNQFCSIHNLHEVYIDLFDQIDENLKTALQRELNEMAPGLFIQAVRVTKPKIPETIRKNYELMEAEKTKLLISIQHQKVVEKDAETERKRAVIEAEKEAQIAKIQYEQKVMEQESKQRVAKIEG

ccccccHHHHHccHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcEEEEcccCEEEEEEcccccccccccCEEEEcccccEEEEEEEEEEECcccccccccccccEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

*********************************************AMADSLLVGIVSLFSLLLVFNYSFHKIEEGHVGVYFRGGALLSTISGPGFHAMIPFITTFRHVQVTLQTDEVKNVPCGTSGGVMIYFDRIEVVNVLSVSSVYDIVKNYTADYDKALIFNKVHHELNQFCSIHNLHEVYIDLFDQIDENLKTALQRELNEMAPGLFIQAVRVTKPKIPETIRKNYELMEAEKTKLLISIQHQK**************************************QRVA****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Erlin-1	Mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs).	very confident	Q58EG2
Erlin-1	Component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs).	very confident	Q91X78
Erlin-2	Component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs). Also involved in ITPR1 degradation by the ERAD pathway.	very confident	Q5R7C5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005789 [CC]	endoplasmic reticulum membrane	confident	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0043234 [CC]	protein complex	confident	GO:0005575, GO:0032991
GO:0005886 [CC]	plasma membrane	confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0030433 [BP]	ER-associated protein catabolic process	confident	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0008219 [BP]	cell death	probable	GO:0010259, GO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK6, chain A
Confidence level:confident
Coverage over the Query: 101-232,251-277
View the alignment between query and template
View the model in PyMOL

Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 69-224
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 222-287
View the alignment between query and template
View the model in PyMOL