Diaphorina citri psyllid: psy9121

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---

MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY

cEEEEccccccccEEEEEEccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEccccccccccccccccccccEEEEcccccccccccEEcccccccEEEECcHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHccEEEcccCEEcc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Integrator complex subunit 9	Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.	confident	Q9NV88
Integrator complex subunit 9	Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.	confident	Q2KJA6
Integrator complex subunit 9	Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.	confident	Q8K114

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0034472 [BP]	snRNA 3'-end processing	probable	GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0016180, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0034470, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0043628, GO:0046483, GO:0016070, GO:0044238, GO:0016073, GO:0044237, GO:0043170, GO:0006396
GO:0032039 [CC]	integrator complex	probable	GO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I7T, chain A
Confidence level:very confident
Coverage over the Query: 1-34,47-51,86-143,179-202
View the alignment between query and template
View the model in PyMOL

Template: 2AZ4, chain A
Confidence level:confident
Coverage over the Query: 1-36,51-137
View the alignment between query and template
View the model in PyMOL